SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g05151

Feature Type:gene_model
Chromosome:Gm10
Start:3987136
stop:3988097
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g05151
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12730AT Annotation by Michelle Graham. TAIR10: FASCICLIN-like arabinogalactan 2 | chr4:7491598-7492809 REVERSE LENGTH=403 SoyBaseE_val: 2.00E-28ISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
UniRef100_B9I1A6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Fasciclin-like arabinogalactan protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9I1A6_POPTR SoyBaseE_val: 2.00E-32ISS
UniRef100_I1N0A1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N0A1_SOYBN SoyBaseE_val: 4.00E-41ISS

Expression Patterns of Glyma10g05151
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g05151 not represented in the dataset
Glyma10g05151 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g05151 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g044900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g05151
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g05151
>Glyma10g05151.1   sequence type=CDS   gene model=Glyma10g05151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCATTGCTCGTCCTCGCCACCCTCTCCGACACACACAACATCACCAACATCCTCGCAAAGCACCCTGAGTTCTCCACCTTTAAGCACTACCTCACCCTCTCCCACCTCGTCCCCGAAATCAACGGCAAAACCACCATCACCGTCTGTGCCGTCAACAAAGCCGCCATGTCGGACCTTCTCTCGAAGCACCCCTCCATCTACACCGTCAAGAACGTCCTCTCCCTCCATGTCCTCCTTGACTACTTTGGTGCCAAGAAGCACCACTAG
Predicted protein sequences of Glyma10g05151
>Glyma10g05151.1   sequence type=predicted peptide   gene model=Glyma10g05151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAALLVLATLSDTHNITNILAKHPEFSTFKHYLTLSHLVPEINGKTTITVCAVNKAAMSDLLSKHPSIYTVKNVLSLHVLLDYFGAKKHH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo