SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g05010

Feature Type:gene_model
Chromosome:Gm10
Start:3901872
stop:3903350
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g05010
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53720AT Annotation by Michelle Graham. TAIR10: cation/H+ exchanger 20 | chr3:19905826-19910027 REVERSE LENGTH=842 SoyBaseE_val: 4.00E-95ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006885GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of pH SoyBaseN/AISS
GO:0030007GO-bp Annotation by Michelle Graham. GO Biological Process: cellular potassium ion homeostasis SoyBaseN/AISS
GO:0030104GO-bp Annotation by Michelle Graham. GO Biological Process: water homeostasis SoyBaseN/AISS
GO:0035725GO-bp Annotation by Michelle Graham. GO Biological Process: sodium ion transmembrane transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0012505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endomembrane system SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005451GO-mf Annotation by Michelle Graham. GO Molecular Function: cation transport SoyBaseN/AISS
GO:0015299GO-mf Annotation by Michelle Graham. GO Molecular Function: solute:hydrogen antiporter activity SoyBaseN/AISS
GO:0015385GO-mf Annotation by Michelle Graham. GO Molecular Function: sodium:hydrogen antiporter activity SoyBaseN/AISS
UniRef100_I1L8K6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L8K6_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q2HVU7UniRef Annotation by Michelle Graham. Most informative UniRef hit: K(+)/H(+) antiporter n=1 Tax=Medicago truncatula RepID=Q2HVU7_MEDTR SoyBaseE_val: 1.00E-97ISS

Expression Patterns of Glyma10g05010
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g05010
ParalogEvidenceComments
Glyma13g19370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g05010 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g05010
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g05010
>Glyma10g05010.1   sequence type=CDS   gene model=Glyma10g05010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATTAGAGGTGTTAAACGATGAAATGTTTGCAATTTTGGTTCTTATGGCTCTATTCACCACCTTCATTACAACCCCAATAGTGTTGTCTCCTTCTATCATTAATTTCATTGAGGCAATTCAGAGCATCCAAAACTCCTCCCTCAAACTCTTCATCATGCACCTTGTTGAGCTCACAGAACACTCTTCCTCCATCATCTTGGCTCAGAACACTAATAATAAGAGTGGCTCTAACCATGTTGAGTGGCTAGAGCAACTTTATAGGGCCTTCCAAGCCCATGCTCAATTGGATAAGAAAATGGTGACCATGATCATCTTGCCTTTCCACAAGCGATGGAGGAAGGTGGAAATGGAAAATGAGGAGGATAATAATAATGAGGTTTCCCAACACCAAACGGAGGAAAATATTGGCCATGGGTGGAGAGGTGTGAACCAAAGGGTACTTAAGAATGCACCTTGCACTGTGGCTATGCTTGTTGATAGAGGATATTTGGTCCTATCTACGACCGTGACCCAACATTTTTGTGTTTTGTTCTTTGGTGGGCCCGATGATGATCGTGAGGCCTTGGAGTTGGGGGATAGAATATCTAACCATCCAGCGGTTAAAGTGACTGTTGTGAGGTTCATTCACAAAGATGTGTTGGAAGGTAATGACATGTCACACTCTTCACCAAGCAAAACTAATGGGAAAAATTACAACTTAGCCATATCTAAAGTGTACCCTCCAAATGAAAAGGAGCTAGATGATGCAACAATGGCAAGGTTCCAAAGCAAGTGGAATGGAATGGTAGAGTGTGATGAGAAGGTAGCTAGTAATATTATGGAAGAGGTGTTAGCATTAGGGCGAAGTAAGGAGTATGAACTCATAATTATTGAGAAAGGTCGATTTCCGTTGAGTTTGGTGGCAGATTTGGTAGACAGGCAGGTAGAGCCCGATGAATTAGGTCCTATTGGAGACATTTTAGCATCATCAACACATGATGTGGTTTCTTCAGTATTAGTAATTCAACAACTTAAATGGCATTTAATT
Predicted protein sequences of Glyma10g05010
>Glyma10g05010.1   sequence type=predicted peptide   gene model=Glyma10g05010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLEVLNDEMFAILVLMALFTTFITTPIVLSPSIINFIEAIQSIQNSSLKLFIMHLVELTEHSSSIILAQNTNNKSGSNHVEWLEQLYRAFQAHAQLDKKMVTMIILPFHKRWRKVEMENEEDNNNEVSQHQTEENIGHGWRGVNQRVLKNAPCTVAMLVDRGYLVLSTTVTQHFCVLFFGGPDDDREALELGDRISNHPAVKVTVVRFIHKDVLEGNDMSHSSPSKTNGKNYNLAISKVYPPNEKELDDATMARFQSKWNGMVECDEKVASNIMEEVLALGRSKEYELIIIEKGRFPLSLVADLVDRQVEPDELGPIGDILASSTHDVVSSVLVIQQLKWHLI






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo