Report for Sequence Feature Glyma10g04930
Feature Type: gene_model
Chromosome: Gm10
Start: 3846161
stop: 3846933
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g04930
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_C6T0H4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0H4_SOYBN
SoyBase E_val: 2.00E-54 ISS
Expression Patterns of Glyma10g04930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g04930
Paralog Evidence Comments
Glyma13g19290 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g04930 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g043100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g04930
Coding sequences of Glyma10g04930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g04930.1 sequence type=CDS gene model=Glyma10g04930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTAGGTGGTGCATGATCTTGGTGGTTCTTGCTCTTGCCGTGGTTGCAAGTGCCAGAAACATGCCCAATGACGCTGGTTTGGAGGACCAGAAGAACTTCCTTGGGTATGGGTTTTCGGGAGTTGGCAACAATGGCCTTCCCTTTGGTGGAGTGGGTTCTGGGTTTGATGGTAATATGGGTGGGCCTTCTGGGCTCGGAGGACTTGGAGGATTCGGTGGGCCTGGTGGGCTTGGCGGACTCGGAGGTCCTGGTAACGGTGAAGGACCCAGTCTTCCTCTCCCTTGA
Predicted protein sequences of Glyma10g04930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g04930.1 sequence type=predicted peptide gene model=Glyma10g04930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MARWCMILVVLALAVVASARNMPNDAGLEDQKNFLGYGFSGVGNNGLPFGGVGSGFDGNMGGPSGLGGLGGFGGPGGLGGLGGPGNGEGPSLPLP*