Glyma10g04790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g04790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g04790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g04790

Feature Type:	gene_model
Chromosome:	Gm10
Start:	3741504
stop:	3743064
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g04790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G20260	AT	Annotation by Michelle Graham. TAIR10: photosystem I subunit E-2 \| chr2:8736780-8737644 FORWARD LENGTH=145	SoyBase	E_val: 1.00E-37	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009522	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem I	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009538	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem I reaction center	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
PF02427	PFAM	Photosystem I reaction centre subunit IV / PsaE	JGI		ISS
UniRef100_C6SWZ1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Papilionoideae RepID=C6SWZ1_SOYBN	SoyBase	E_val: 2.00E-85	ISS
UniRef100_G7KZJ5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I reaction center subunit IV A n=1 Tax=Medicago truncatula RepID=G7KZJ5_MEDTR	SoyBase	E_val: 4.00E-52	ISS

Expression Patterns of Glyma10g04790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g04790 not represented in the dataset	Glyma10g04790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g04790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g042100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g04790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g04790

Limit To All Plant Sequences

>Glyma10g04790.1   sequence type=CDS   gene model=Glyma10g04790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCAGCAGCATCTGGGTTTGTGTTGTCACTTAATGTTGCAGCTGCCACCACAAACTCAAGGGTGGTCATGTTCAACACCAAGAACAACACTTCTAGGTTTGTTGTAAAGGCTTCAGATGAGCCTGCAGCGGCGGCACCCGCCACCGCCACACCCCCAGCTGAAGCTGAAGCTAAACCAAAGCCACCACCTATTGGCCCCAAGAGAGGTGCTAAGGTGAAGATTCTTAGGAAGGAATCTTACTGGTACAAAGGCACCGGTTCAGTGGTTGCTGTTGATCAGGACCCCAACACTCGCTACCCTGTTGTGGTTCGATTCAACAAAGTCAACTATGCCAATGTATCAACAAACAACTATGCTTTGGATGAGATCGTGGAAGTCGAATGA

Predicted protein sequences of Glyma10g04790

Limit To All Plant Sequences

>Glyma10g04790.1   sequence type=predicted peptide   gene model=Glyma10g04790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASAASGFVLSLNVAAATTNSRVVMFNTKNNTSRFVVKASDEPAAAAPATATPPAEAEAKPKPPPIGPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEVE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain