SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g04780

Feature Type:gene_model
Chromosome:Gm10
Start:3737135
stop:3738791
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g04780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20260AT Annotation by Michelle Graham. TAIR10: photosystem I subunit E-2 | chr2:8736780-8737644 FORWARD LENGTH=145 SoyBaseE_val: 3.00E-39ISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009522GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009538GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I reaction center SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
PF02427PFAM Photosystem I reaction centre subunit IV / PsaE JGI ISS
UniRef100_C6TC81UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TC81_SOYBN SoyBaseE_val: 3.00E-85ISS
UniRef100_G7KZJ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I reaction center subunit IV A n=1 Tax=Medicago truncatula RepID=G7KZJ5_MEDTR SoyBaseE_val: 4.00E-53ISS

Expression Patterns of Glyma10g04780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g04780
ParalogEvidenceComments
Glyma13g19190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g04780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g042000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g04780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g04780
>Glyma10g04780.1   sequence type=CDS   gene model=Glyma10g04780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCAGCAGCATCTGGGTTTGTGTTGTCACTTAATGTTGCAGCTGCCACCACAAACTCAAGGGTGGTCATGTTCAACACAAAGAACAACGCTTCTAGGCTTGTTGTAAGGGCTTCAGATGAGCCTGCAGCGGCGGCACCCGCCACCGCCACACCCCCAGCTGAAGCTGAAGCTAAACCAAAGCCACCACCTATTGGCCCCAAGAGAGGTGCTAAGGTGAAGATTCTTAGGAAGGAATCTTACTGGTACAAAGGCACTGGTTCAGTGGTTGCTGTTGATCAGGACCCCAACACTCGCTACCCTGTTGTGGTTCGATTCAACAAAGTCAACTATGCCAATGTATCAACAAACAACTATGCTTTGGATGAGATTGTGGAAGTGGAATGA
Predicted protein sequences of Glyma10g04780
>Glyma10g04780.1   sequence type=predicted peptide   gene model=Glyma10g04780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASAASGFVLSLNVAAATTNSRVVMFNTKNNASRLVVRASDEPAAAAPATATPPAEAEAKPKPPPIGPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEVE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo