Report for Sequence Feature Glyma10g04690
Feature Type: gene_model
Chromosome: Gm10
Start: 3605360
stop: 3606476
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g04690
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G04300 AT
Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein | chr3:1140318-1140723 FORWARD LENGTH=96
SoyBase E_val: 1.00E-43 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF05899 PFAM
Protein of unknown function (DUF861)
JGI ISS
UniRef100_B6T5M3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Enzyme of the cupin superfamily n=1 Tax=Zea mays RepID=B6T5M3_MAIZE
SoyBase E_val: 3.00E-44 ISS
UniRef100_I1L8I2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L8I2_SOYBN
SoyBase E_val: 9.00E-74 ISS
Expression Patterns of Glyma10g04690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g04690
Paralog Evidence Comments
Glyma13g19020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g04690 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g041200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g04690
Coding sequences of Glyma10g04690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g04690.1 sequence type=CDS gene model=Glyma10g04690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTCAGATTCCAATTCATCAAACCTTAGAATCACCATTGAAAGCAATCCTCCCGAGTCACGCCTAGCCGAATTGAACATCAAGTATTGGCCAAAATGGGGTTGTTCTCCAGGGAAGTACCAATTGAAGTTTGATGCTGAAGAAACATGCTATTTGCTGAAAGGGAAGGTGAAGGCATATCCAAAAGGGTCATCAGAGTTTGTAGAGTTTGGTGCTGGAGACCTTGTGACCATACCAAGGGGACTCAATTGCACTTGGGATGTGTCAGTTGCTGTGGACAAGTGCTACAAATTCGAGTCATCAAATTCTTCTTCATCATCTTCTTCCTAG
Predicted protein sequences of Glyma10g04690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g04690.1 sequence type=predicted peptide gene model=Glyma10g04690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASDSNSSNLRITIESNPPESRLAELNIKYWPKWGCSPGKYQLKFDAEETCYLLKGKVKAYPKGSSEFVEFGAGDLVTIPRGLNCTWDVSVAVDKCYKFESSNSSSSSSS*