SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g04630

Feature Type:gene_model
Chromosome:Gm10
Start:3559987
stop:3562554
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g04630
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G28660AT Annotation by Michelle Graham. TAIR10: photosystem II reaction center PSB28 protein | chr4:14150008-14150933 FORWARD LENGTH=183 SoyBaseE_val: 2.00E-68ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009539GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II reaction center SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03912PFAM Psb28 protein JGI ISS
UniRef100_I1L8H7UniRef Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center psb28 protein n=1 Tax=Glycine max RepID=I1L8H7_SOYBN SoyBaseE_val: 4.00E-130ISS
UniRef100_I1L8H7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center psb28 protein n=1 Tax=Glycine max RepID=I1L8H7_SOYBN SoyBaseE_val: 4.00E-130ISS

Expression Patterns of Glyma10g04630
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g04630
ParalogEvidenceComments
Glyma13g18930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g04630 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g040600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g04630
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g04630
>Glyma10g04630.1   sequence type=CDS   gene model=Glyma10g04630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACCCTCCACTCTCTTGCATTGTCCTCTCCACTCTCCAACTCACTTCAGAAGCCGCACTCATATGCAGTCCCATCTTCAATTGTTCATCAAAGTACAAACTCTTCATTCAATGGTCAAACTTTACGCATGCCATGTTTGAGGTTACCTGTGCTAAGACAAAGTACTCCCATGCACATGCCAGTTATCATGATGGCCAAACCAAAAATACAGTTCATCCAGGGAACTGATGAACAAACAATACCCGATGTGAGGCTGACCAAATCAAGGGATGGAACAAATGGCATGGCTATCTTCACATTTGATCAACCCTCGGTATTCGATTCTTCCGGTGAAATAGGTGATATCACCGGGTTTTACATGATTGATGAGGAAGGAGTCCTTCAGTCGGTTGATGTAAGTGCTAAATTTGTCAATGGGAAGCCCTCAATAATTGAAGCCAAGTATGTAATGCGGAGTCCAAGGGAGTGGGATAGATTCATGAGATTCATGGAGCGATACTCAAATGCAAATGGTTTGCAATTTGTCAAAAAATGA
Predicted protein sequences of Glyma10g04630
>Glyma10g04630.1   sequence type=predicted peptide   gene model=Glyma10g04630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLHSLALSSPLSNSLQKPHSYAVPSSIVHQSTNSSFNGQTLRMPCLRLPVLRQSTPMHMPVIMMAKPKIQFIQGTDEQTIPDVRLTKSRDGTNGMAIFTFDQPSVFDSSGEIGDITGFYMIDEEGVLQSVDVSAKFVNGKPSIIEAKYVMRSPREWDRFMRFMERYSNANGLQFVKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo