SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g04560

Feature Type:gene_model
Chromosome:Gm10
Start:3519624
stop:3521121
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g04560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04400AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L14p/L23e family protein | chr3:1167339-1168308 FORWARD LENGTH=140 SoyBaseE_val: 1.00E-96ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0901 KOG 60S ribosomal protein L14/L17/L23 JGI ISS
PTHR11761Panther 50S RIBOSOMAL PROTEIN L14-RELATED JGI ISS
PF00238PFAM Ribosomal protein L14p/L23e JGI ISS
UniRef100_B3TLN0UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L17 n=13 Tax=Magnoliophyta RepID=B3TLN0_ELAGV SoyBaseE_val: 9.00E-95ISS
UniRef100_C6T0H9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0H9_SOYBN SoyBaseE_val: 4.00E-95ISS

Expression Patterns of Glyma10g04560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g04560
ParalogEvidenceComments
Glyma13g18830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g04560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g039900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g04560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g04560
>Glyma10g04560.1   sequence type=CDS   gene model=Glyma10g04560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAAGCGTGGTCGTGGTGGTTCGGCGGGGAACAAGTTCCGCATGTCGCTGGGTCTTCCAGTGGCGGCGACGGTGAACTGCGCCGACAACACGGGGGCGAAGAACCTCTACATCATTTCGGTGAAAGGGATCAAAGGCCGTTTGAACCGTCTTCCCTCGGCCTGCGTTGGCGACATGGTGATGGCCACCGTGAAGAAGGGAAAACCCGATCTGAGGAAGAAGGTCTTGCCAGCTGTCATCGTTCGCCAGCGCAAGCCATGGCGCCGAAAGGACGGCGTCTACATGTACTTCGAAGATAATGCTGGTGTTATTGTCAATCCCAAGGGAGAAATGAAAGGTTCTGCTATCACTGGTCCCATTGGAAAAGAGTGTGCTGATTTGTGGCCTAGGATTGCAAGTGCAGCTAACGCCATCGTTTGA
Predicted protein sequences of Glyma10g04560
>Glyma10g04560.1   sequence type=predicted peptide   gene model=Glyma10g04560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo