SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g04220

Feature Type:gene_model
Chromosome:Gm10
Start:3220889
stop:3221449
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g04220
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G01640AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages. | chr2:283085-284034 FORWARD LENGTH=156 SoyBaseE_val: 1.00E-21ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1L8D6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L8D6_SOYBN SoyBaseE_val: 6.00E-68ISS
UniRef100_Q9ZU92UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZU92_ARATH SoyBaseE_val: 5.00E-19ISS

Expression Patterns of Glyma10g04220
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g04220 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g04220
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g04220
>Glyma10g04220.1   sequence type=CDS   gene model=Glyma10g04220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAAAGAAAAAGACCAAACAACAAAGGTGGCAGAAGAAATTGAAGGCATATAATCTATCTTCACTTTTAGAGTCCCTTCCTGAGGTGAAGGCATCAAAGAAACCAGGTTACGAGAATGACAGCAAACTTAAGTGTAAATCCAGGCAGATGTTAGTATTGAGTGAAAGAGATCGAATTTCTGCTGTTCTCGACGATCCTACCTTTCAAGCGGATCCACTGTCTGCCACTCATGAATATGTACAGAACAAACAACCGGTAGTAGAGGAACAACCCAAGAAAAAAGTGAACAAAAATGGATCCAAGAAGAAGAAATCAAAGGCTTCAACTGGGCTACAATCTATGGAAATTTAG
Predicted protein sequences of Glyma10g04220
>Glyma10g04220.1   sequence type=predicted peptide   gene model=Glyma10g04220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKKKTKQQRWQKKLKAYNLSSLLESLPEVKASKKPGYENDSKLKCKSRQMLVLSERDRISAVLDDPTFQADPLSATHEYVQNKQPVVEEQPKKKVNKNGSKKKKSKASTGLQSMEI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo