Glyma10g04170 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g04170

Feature Type:	gene_model
Chromosome:	Gm10
Start:	3159560
stop:	3160081
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g04170

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G23240	AT	Annotation by Michelle Graham. TAIR10: ethylene response factor 1 \| chr3:8295705-8296361 FORWARD LENGTH=218	SoyBase	E_val: 5.00E-50	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_D8VD37	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ethylene response factor 10 n=1 Tax=Actinidia deliciosa RepID=D8VD37_ACTDE	SoyBase	E_val: 6.00E-52	ISS
UniRef100_I1L8D3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L8D3_SOYBN	SoyBase	E_val: 2.00E-118	ISS

Expression Patterns of Glyma10g04170

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g04170

Paralog	Evidence	Comments
Glyma13g18370	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g04170 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g036300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g04170

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g04170

Limit To All Plant Sequences

>Glyma10g04170.2   sequence type=CDS   gene model=Glyma10g04170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGACTTCTCCACAGCACCAACAACAGAAGGAAACCACAACGATGAGGCAAAGCAATTGGTGGTGAAATCTGAAGGGCAGAATAAGCAAAGGTCTTACATTGGTGTGAGAAAAAGGCCTTGGGGAAAATTTGCAGCAGAGATCAGAGACACAACGAGGAATGGCACTAGGGTTTGGCTTGGAACCTTTGACACTGCAGAGGCTGCTGCTTTGGCTTATGACCAAGCTGCATTTTCCATGAGAGGCCAAAGTGCTGTACTCAATTTTCCAGTCAAAAGGGTCAAAGAGTCTTTGCAAGAGATCCAATATAGCTGCTTCTTCAATGGATCTTCTTCTCCCGCACTTGCACTCAAAGAGAGGCACTGCATCCAAAGAAAATTGTCATCAAAAGGTAAAAAGTGTAAAGGGAAAGAGACATCAGAAAGTGTGGTTGTGTTAGAAGATTTGGGAGTTGACTATCTAGAGCAACTTCTAAGCTTATCTGATCAAAGTGAAAGCCCTAGCTACTTCAACTATTAA

Predicted protein sequences of Glyma10g04170

Limit To All Plant Sequences

>Glyma10g04170.2   sequence type=predicted peptide   gene model=Glyma10g04170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVDFSTAPTTEGNHNDEAKQLVVKSEGQNKQRSYIGVRKRPWGKFAAEIRDTTRNGTRVWLGTFDTAEAAALAYDQAAFSMRGQSAVLNFPVKRVKESLQEIQYSCFFNGSSSPALALKERHCIQRKLSSKGKKCKGKETSESVVVLEDLGVDYLEQLLSLSDQSESPSYFNY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain