Glyma10g04070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g04070

Feature Type:	gene_model
Chromosome:	Gm10
Start:	3074151
stop:	3077166
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g04070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14420	AT	Annotation by Michelle Graham. TAIR10: HR-like lesion-inducing protein-related \| chr4:8302171-8303738 REVERSE LENGTH=158	SoyBase	E_val: 5.00E-62	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
PF05514	PFAM	HR-like lesion-inducing	JGI		ISS
UniRef100_I1L8C5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L8C5_SOYBN	SoyBase	E_val: 9.00E-107	ISS
UniRef100_Q7XSC5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: OSJNBa0027O01.6 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XSC5_ORYSJ	SoyBase	E_val: 9.00E-66	ISS

Expression Patterns of Glyma10g04070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g04070

Paralog	Evidence	Comments
Glyma13g18230	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g04070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g035300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g04070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g04070

Limit To All Plant Sequences

>Glyma10g04070.1   sequence type=CDS   gene model=Glyma10g04070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTTCGCTTCTTTCCTCGGCAGAGTTCTCTTCGCTTCCGTCTTCATACTCTCTGCTTACCAAGAATTTAACGAATTTGGAGTTGATGGGGGACCTGCAGCAAAAGCACTCAGACCTAAGTTTGATGCCTTTACACATCGAGTGCATTCTCAAGTTGGCTTTCAACTTCCTGAGATTGATCTGAAATTTTTAATTGCTGGGGCTATTGCTCTGAAGGGCCTTGGAGGGGTTCTTTTCATATTTGGCAGCTCTTTTGGAGCTTTGCTTCTGCTCCTGCACCAGCTGATTGCTACCCCAATCCATTATGATTTTTACAATTATGACAGTGAGGACAAAGAATTTACTCAACTGTTCATCAAATTTACACAGAACATGGCTCTTTTCGGGGCTCTATTGTTTTTCATTGGCATGAAAAACTCCATCCCTAGAAGGGTACCCAAGAAGGCTCCAAAGACAAAAACCTATTAG

Predicted protein sequences of Glyma10g04070

Limit To All Plant Sequences

>Glyma10g04070.1   sequence type=predicted peptide   gene model=Glyma10g04070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFASFLGRVLFASVFILSAYQEFNEFGVDGGPAAKALRPKFDAFTHRVHSQVGFQLPEIDLKFLIAGAIALKGLGGVLFIFGSSFGALLLLLHQLIATPIHYDFYNYDSEDKEFTQLFIKFTQNMALFGALLFFIGMKNSIPRRVPKKAPKTKTY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain