SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g03850

Feature Type:gene_model
Chromosome:Gm10
Start:2888576
stop:2889450
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g033400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g03850.1   sequence type=CDS   gene model=Glyma10g03850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAACAGACCTAGGGCAGGATTTGTGTCGCAAAACCTGATCTGTGATGGTGATTTCCCAGCTTTGTTTTGGGCCTCAATGTTCTCTCATTCTCCTCTGTTTTGGTGCAACCAAATTTGCATCTGTGGTGGTGTTTTTTCCCAGCTTTGTTTTGGGTCTCAACATTCTCTCTCGTTCTCCTCTGTTTTGGTGCGACCAGATTTTGCATTTGTGGTGGTGTTTTTAATTTTTTAG

>Glyma10g03850.1   sequence type=predicted peptide   gene model=Glyma10g03850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQNRPRAGFVSQNLICDGDFPALFWASMFSHSPLFWCNQICICGGVFSQLCFGSQHSLSFSSVLVRPDFAFVVVFLIF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo