SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03720

Feature Type:gene_model
Chromosome:Gm10
Start:2776959
stop:2780188
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g03720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23050AT Annotation by Michelle Graham. TAIR10: indole-3-acetic acid 7 | chr3:8194768-8196716 FORWARD LENGTH=243 SoyBaseE_val: 8.00E-98ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009269GO-bp Annotation by Michelle Graham. GO Biological Process: response to desiccation SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0040008GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008180GO-cc Annotation by Michelle Graham. GO Cellular Compartment: signalosome SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_C6TDX6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6TDX6_SOYBN SoyBaseE_val: 2.00E-180ISS
UniRef100_P13089UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein AUX28 n=2 Tax=Glycine max RepID=AUX28_SOYBN SoyBaseE_val: 5.00E-122ISS

Expression Patterns of Glyma10g03720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g03720
ParalogEvidenceComments
Glyma02g16080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g03720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g031900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g03720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma10g03720
>Glyma10g03720.2   sequence type=transcript   gene model=Glyma10g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCCCCAACTCCAACGTAATAACGTGCCTGCCCCTATACCTCACCCCCACCCACTATTATTATTGTACTACAACACAATCAAGTCCCTGAATGCTTTTTAGAGAGAGAAAGAGTCATAATAAAGTGAAAGAAAAAGAAAAAGGAGAGTAGTGAAACAAGAAGAAAGGAGAAGAAGATGGTGTTTGAGGAAACTGAGCTGAGGCTTGGACTGAGACTAGGACTCCCTGGAAATGGAGCCGCGCCAACAACTGAAGCTGCTGCGGAATTAGGAGTGAGGAAGAGAGGGTTCTCTGAAACTGAAACCGATGAAACAACCTCCGTTGATTTGATGCTTAACCTCTCTCCCAAGGAAGCTTCTGCTGCTGCTACTACTGATGGAGCAGATCCACGTGAGAATCCAAAGACTTCGCCGAAGGAGAAGAATCTTCCTCTTCTCGATCCCGCAAAGCCTCCTGCCAAGGCGCAAGTGGTGGGATGGCCACCTGTAAGGTCTTTCCGGAAGAACATGTTTGCAGCCCAAAAGAGCAGCGGCGGAGAGGAAAGCGAGAAGAACAGCCCTAATGCAAGCTTTGTCAAAGTTAGCATGGATGGAGCACCTTACCTCCGCAAAGTTGACTTGAAGATGTACAAGAGTTACCCTGAGCTCTCTGATGCCTTGGGCAAAATGTTTAGCTCCTTCACCATTGGAAATTGTGAATCCCAAGGCTTCAAGGATTTCATGAATGAGAGCAAGTTGATGGATCTTCTGAACAGCTCCGACTATGTCCCGACCTATGAAGACAGGGATGGCGACTGGATGCTTGTCGGTGATGTGCCATGGGAGTAATTTTTTTTTTTCTCCACTTGATGACCCGATCGAAATTATTTTGGTTGCAATAATTTGACCTTGTAATAGTTTCAATGAAAAAGAATATGGAACACAAAAGGCAGAAAAAAGAAGACAGGAGCTTGATATGCACATCACAATGTTACTTCAAAACTAGTCCTTATCCAAGAAACTTTGCGTAAAATATTATGCATGTTCTAAGGAAATCATGGGTTATCATCTTGATTTTTTTTTTATCATGTCCATGTGCATCAGAATAAGTACATCCTTTTATTGTGCTAACCAATTAGTGATGTTGTTTTGGTTAATTATTGGTACACCAAGAGTCATAAAAATATACAATATGTCTTTTGAGATGTCATTTTTTTTCCAAGATGACAATGAACACACAAACTATAGCATTGATAAACCATGGAAAATTTTCGAAACAGCCTCCCAT
Coding sequences of Glyma10g03720
>Glyma10g03720.1   sequence type=CDS   gene model=Glyma10g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTTGAGGAAACTGAGCTGAGGCTTGGACTGAGACTAGGACTCCCTGGAAATGGAGCCGCGCCAACAACTGAAGCTGCTGCGGAATTAGGAGTGAGGAAGAGAGGGTTCTCTGAAACTGAAACCGATGAAACAACCTCCGTTGATTTGATGCTTAACCTCTCTCCCAAGGAAGCTTCTGCTGCTGCTACTACTGATGGAGCAGATCCACGTGAGAATCCAAAGACTTCGCCGAAGGAGAAGAATCTTCCTCTTCTCGATCCCGCAAAGCCTCCTGCCAAGGCGCAAGTGGTGGGATGGCCACCTGTAAGGTCTTTCCGGAAGAACATGTTTGCAGCCCAAAAGAGCAGCGGCGGAGAGGAAAGCGAGAAGAACAGCCCTAATGCAAGCTTTGTCAAAGTTAGCATGGATGGAGCACCTTACCTCCGCAAAGTTGACTTGAAGATGTACAAGAGTTACCCTGAGCTCTCTGATGCCTTGGGCAAAATGTTTAGCTCCTTCACCATTGGAAATTGTGAATCCCAAGGCTTCAAGGATTTCATGAATGAGAGCAAGTTGATGGATCTTCTGAACAGCTCCGACTATGTCCCGACCTATGAAGACAGGGATGGCGACTGGATGCTTGTCGGTGATGTGCCATGGGAGATGTTTGTTGAATCATGCAAGCGTTTACGTATCATGAAAGGAAAGGAAGCTATTGGACTGGCACCAAGAGCCGTGGAGAAATGCAAGAACAGGAGCTAG

>Glyma10g03720.2   sequence type=CDS   gene model=Glyma10g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTTGAGGAAACTGAGCTGAGGCTTGGACTGAGACTAGGACTCCCTGGAAATGGAGCCGCGCCAACAACTGAAGCTGCTGCGGAATTAGGAGTGAGGAAGAGAGGGTTCTCTGAAACTGAAACCGATGAAACAACCTCCGTTGATTTGATGCTTAACCTCTCTCCCAAGGAAGCTTCTGCTGCTGCTACTACTGATGGAGCAGATCCACGTGAGAATCCAAAGACTTCGCCGAAGGAGAAGAATCTTCCTCTTCTCGATCCCGCAAAGCCTCCTGCCAAGGCGCAAGTGGTGGGATGGCCACCTGTAAGGTCTTTCCGGAAGAACATGTTTGCAGCCCAAAAGAGCAGCGGCGGAGAGGAAAGCGAGAAGAACAGCCCTAATGCAAGCTTTGTCAAAGTTAGCATGGATGGAGCACCTTACCTCCGCAAAGTTGACTTGAAGATGTACAAGAGTTACCCTGAGCTCTCTGATGCCTTGGGCAAAATGTTTAGCTCCTTCACCATTGGAAATTGTGAATCCCAAGGCTTCAAGGATTTCATGAATGAGAGCAAGTTGATGGATCTTCTGAACAGCTCCGACTATGTCCCGACCTATGAAGACAGGGATGGCGACTGGATGCTTGTCGGTGATGTGCCATGGGAGTAA
Predicted protein sequences of Glyma10g03720
>Glyma10g03720.1   sequence type=predicted peptide   gene model=Glyma10g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFEETELRLGLRLGLPGNGAAPTTEAAAELGVRKRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPAKAQVVGWPPVRSFRKNMFAAQKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS*

>Glyma10g03720.2   sequence type=predicted peptide   gene model=Glyma10g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFEETELRLGLRLGLPGNGAAPTTEAAAELGVRKRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPAKAQVVGWPPVRSFRKNMFAAQKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDVPWE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo