SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03710

Feature Type:gene_model
Chromosome:Gm10
Start:2760232
stop:2762330
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g03710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43700AT Annotation by Michelle Graham. TAIR10: AUX/IAA transcriptional regulator family protein | chr5:17550465-17551206 FORWARD LENGTH=186 SoyBaseE_val: 2.00E-63ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0007020GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule nucleation SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_C6T9X8UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T9X8_SOYBN SoyBaseE_val: 4.00E-121ISS
UniRef100_O24542UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 22D n=1 Tax=Vigna radiata var. radiata RepID=AX22D_VIGRR SoyBaseE_val: 9.00E-96ISS

Expression Patterns of Glyma10g03710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g03710
ParalogEvidenceComments
Glyma02g16090 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g03710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g031800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g03710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g03710
>Glyma10g03710.2   sequence type=CDS   gene model=Glyma10g03710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAAGTACGAAAAAGAGCTTAATCTCGAGGCTACAGAGTTGAGATTGGGGTTGCCTGGAAGCGATGAGCCTGGGAAACGTTCTATTGTTAGAAGCAATAAGAGATCTTCAACAGAAGCAAGCGAGGAAGAGTGCATAAGCAAGGGCAACATGAATTCTAATGGTTCTGATATCACAAGTGATGACCAAGACAACCTTGTGCCACCTGCAAAAGCACAAGTAGTGGGATGGCCACCGGTTCGATCATATAGGAAGAATACTCTACAACAAAAGAAAGAGGAACAGGGTGAAGGGTCTGGGATGTACGTGAAAGTTAGCATGGCAGGTGCACCTTACTTAAGGAAGATAGATCTAAATGTTTACAAGAGCTACCCAGAACTTCTCAAGGCCTTGGGAAATATGTTCAAGTGCACATTTGGTGAATATTCAGAAAGGGAAGGGTACAATGGATCTGAATATGCTCCAACTTATGAAGACAAGGATGGGGATTGGATGCTGGTTGGAGATGTTCCATGGAAGTAA
Predicted protein sequences of Glyma10g03710
>Glyma10g03710.2   sequence type=predicted peptide   gene model=Glyma10g03710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKYEKELNLEATELRLGLPGSDEPGKRSIVRSNKRSSTEASEEECISKGNMNSNGSDITSDDQDNLVPPAKAQVVGWPPVRSYRKNTLQQKKEEQGEGSGMYVKVSMAGAPYLRKIDLNVYKSYPELLKALGNMFKCTFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo