SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03601

Feature Type:gene_model
Chromosome:Gm10
Start:2654640
stop:2657550
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g03601
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38290AT Annotation by Michelle Graham. TAIR10: ammonium transporter 2 | chr2:16039672-16042291 REVERSE LENGTH=475 SoyBaseE_val: 1.00E-119ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002237GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0006995GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009581GO-bp Annotation by Michelle Graham. GO Biological Process: detection of external stimulus SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015695GO-bp Annotation by Michelle Graham. GO Biological Process: organic cation transport SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0008519GO-mf Annotation by Michelle Graham. GO Molecular Function: ammonium transmembrane transporter activity SoyBaseN/AISS
GO:0015398GO-mf Annotation by Michelle Graham. GO Molecular Function: high affinity secondary active ammonium transmembrane transporter activity SoyBaseN/AISS
KOG0682 KOG Ammonia permease JGI ISS
PTHR11730Panther AMMONIUM TRANSPORTER JGI ISS
PTHR11730:SF1Panther AMMONIUM TRANSPORTER JGI ISS
PF00909PFAM Ammonium Transporter Family JGI ISS
UniRef100_B9S4Q1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ammonium transporter, putative n=1 Tax=Ricinus communis RepID=B9S4Q1_RICCO SoyBaseE_val: 4.00E-170ISS
UniRef100_UPI000233C7FBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C7FB related cluster n=1 Tax=unknown RepID=UPI000233C7FB SoyBaseE_val: 0ISS

Expression Patterns of Glyma10g03601
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g03601 not represented in the dataset
Glyma10g03601 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g03601
ParalogEvidenceComments
Glyma02g16200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g03601 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g03601
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g03601
>Glyma10g03601.1   sequence type=CDS   gene model=Glyma10g03601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCTGTACGCTTTTGCGGCGGTTCTTGTTTTCTGGGTGGGGTGGTGCTACAAAATGTCATTCGGCGAGAGGATCCTTCCATTTCTGGGGCAGCCAAACACGGCCTTGGACAGGGAATTCGTTTTTCGCCAAGCTTTTGCAGGGGAATTTCCCAACGCCACCATGGTGTACTTTCAGTTGGCTTTTGCTGCCATCAGTATATGGAGAACTGATGGACGGTTGTTCAAGTTGGGCCTCATTGATTACTCCGGTGGCTTTGTTATTCATCTTTCTTCTGGGGTTGCTGGTTTCGTAGGACCAAGGGCAGTGAAGGATAGAGAGAGGTTCCCTCCAAACAACATACTTCTGATGGCTTACCATGGATTCAACGGTGGAGATCCATACGCAGCCAGCATAGATGCATCTCTGGCCGTCCTTAACACCCACGTCTGCACGGCAATGAGCTTGTTGACTTGGCTTTTCCTTGACATACTCTTCTTTGGAAAACCTTCCGTCATTGGTGCCACTCAAGGCATGATCACTGGCCTGGTTTGCAACACCCCTGCTGCCGGTGTGGTGCAAGGTTGGGCAGCAATCATAATGGGAATGATGTCTGGAAGCATCCCATGGTACACAATGATGGTCCTGCACAAAGAAAGTAAGCTACTCAAACAAGTAGATGATACTTCAGCAGTTTTCCACACCCATGCCGTGGCTGGTAGCTTAGGTGGCATTTTGGCTGGTTTCTTTGCTGACCCTAACCTTTGTTATCTCTTCTATGGAGTACAAGATTCCTTGCACTATACGGGTCTTGTTTATGGCATATTCAATGGGAATCTCAAGACAGGGTTCAGGCAAATGGGGGTTCAGCTTCTTGGCATTGTTTTTGTAATACTTCTGAATGTCACCACAACTAGCATTGTGTGTTTGTTGGTTAGGATGATAGTTCCACTTAGGATGAGTGAAGATGACTTGCAAGTTGGGGATGAAGCAGTTCATGGCGAGGTTGCATATGCATTGTGGGGTGATGGAGAGAAGCTTGAGACTGCTGCT
Predicted protein sequences of Glyma10g03601
>Glyma10g03601.1   sequence type=predicted peptide   gene model=Glyma10g03601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALYAFAAVLVFWVGWCYKMSFGERILPFLGQPNTALDREFVFRQAFAGEFPNATMVYFQLAFAAISIWRTDGRLFKLGLIDYSGGFVIHLSSGVAGFVGPRAVKDRERFPPNNILLMAYHGFNGGDPYAASIDASLAVLNTHVCTAMSLLTWLFLDILFFGKPSVIGATQGMITGLVCNTPAAGVVQGWAAIIMGMMSGSIPWYTMMVLHKESKLLKQVDDTSAVFHTHAVAGSLGGILAGFFADPNLCYLFYGVQDSLHYTGLVYGIFNGNLKTGFRQMGVQLLGIVFVILLNVTTTSIVCLLVRMIVPLRMSEDDLQVGDEAVHGEVAYALWGDGEKLETAA






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo