Glyma10g03590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03590

Feature Type:	gene_model
Chromosome:	Gm10
Start:	2650012
stop:	2653309
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g03590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63410	AT	Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein \| chr3:23415816-23417002 REVERSE LENGTH=338	SoyBase	E_val: 0	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0010189	GO-bp	Annotation by Michelle Graham. GO Biological Process: vitamin E biosynthetic process	SoyBase	N/A	ISS
GO:0010236	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastoquinone biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009706	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0008168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity	SoyBase	N/A	ISS
GO:0008757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: S-adenosylmethionine-dependent methyltransferase activity	SoyBase	N/A	ISS
GO:0051741	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 2-methyl-6-phytyl-1,4-benzoquinone methyltransferase activity	SoyBase	N/A	ISS
KOG1540	KOG	Ubiquinone biosynthesis methyltransferase COQ5	JGI		ISS
PTHR10108	Panther	METHYLTRANSFERASE	JGI		ISS
PTHR10108:SF9	Panther	CHLOROPLAST INNER ENVELOPE PROTEIN	JGI		ISS
PF08241	PFAM	Methyltransferase domain	JGI		ISS
UniRef100_B9S4P9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast inner envelope protein, putative n=1 Tax=Ricinus communis RepID=B9S4P9_RICCO	SoyBase	E_val: 0	ISS
UniRef100_I1L880	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L880_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma10g03590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g03590

Paralog	Evidence	Comments
Glyma02g16210	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g03590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g030600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g03590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g03590

Limit To All Plant Sequences

>Glyma10g03590.1   sequence type=CDS   gene model=Glyma10g03590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAGTAATGCTCAGTGGAACTGAAAAGCTCACTCTCAGAACCCTAACCGGAAACGGCTTAGGTTTCACTGGTTCAGATTTGCACGGTAAGAATTTTCCAAGAGTGAGTTTTGTTGCCACCACTAGTGCTAAAGTTCCCAACTTTAGGAGCTTAGTAGTACCCAAGTGTAGTGTCTCTGCTTCGAGGCCAACCTCGCAGCCAAGGTTCATTCAGCACAAAAAAGAGGCGTTTTGGTTCTATAGGTTTCTCTCAATTGTGTATGACCATGTCATTAACCCTGGCCATTGGACCGAGGACATGAGGGATGATGCCCTTGAACCCGCTGATCTCAATGACAGGAACATGATTGTCGTCGATGTCGGCGGCGGCACCGGTTTCACCACTCTTGGTATTGTCAAGCATGTGGATGCCAAGAATGTCACCATTCTTGACCAGTCACCCCACCAGCTTGCTAAGGCCAAGCAGAAGGAACCACTCAAGGAATGCAAAATAATCGAAGGGGATGCCGAGGATCTCCCCTTTCGAACCGATTATGCCGATAGATATGTATCCGCGGGAAGTATTGAATACTGGCCGGATCCACAGCGTGGCATCAAGGAAGCTTACAGGGTTTTGAAACTTGGAGCCAAGGCATGTCTAATTGGTCCGGTCTACCCTACATTTTGGTTGTCACGTTTCTTTGCTGATGTTTGGATGCTTTTCCCCAAGGAGGAAGAGTATATTGAGTGGTTTCAGAAGGCAGGGTTTAAGGACGTCCAACTAAAAAGGATTGGCCCAAAATGGTACCGTGGTGTTCGCCGACATGGCTTGATTATGGGTTGTTCAGTGACCGGTGTTAAGCCTGCATCTGGAGATTCTCCTTTGCAGCTTGGTCCAAAGGAAGAAGATGTTGAAAAGTCCGTTAATCCTTTTGTGTTTGCACTGCGCTTCGTTTTGGGTGCCTTGGCAGCCACATGGTTTGTGTTGGTTCCAATTTACATGTGGCTCAAAGATCAAGTTGTTCCCAAAGGTCAGCCAATCTAA

Predicted protein sequences of Glyma10g03590

Limit To All Plant Sequences

>Glyma10g03590.1   sequence type=predicted peptide   gene model=Glyma10g03590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASVMLSGTEKLTLRTLTGNGLGFTGSDLHGKNFPRVSFVATTSAKVPNFRSLVVPKCSVSASRPTSQPRFIQHKKEAFWFYRFLSIVYDHVINPGHWTEDMRDDALEPADLNDRNMIVVDVGGGTGFTTLGIVKHVDAKNVTILDQSPHQLAKAKQKEPLKECKIIEGDAEDLPFRTDYADRYVSAGSIEYWPDPQRGIKEAYRVLKLGAKACLIGPVYPTFWLSRFFADVWMLFPKEEEYIEWFQKAGFKDVQLKRIGPKWYRGVRRHGLIMGCSVTGVKPASGDSPLQLGPKEEDVEKSVNPFVFALRFVLGALAATWFVLVPIYMWLKDQVVPKGQPI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain