Glyma10g03510 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03510

Feature Type:	gene_model
Chromosome:	Gm10
Start:	2552182
stop:	2554794
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g03510

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G03070	AT	Annotation by Michelle Graham. TAIR10: Bax inhibitor-1 family protein \| chr1:730148-731379 FORWARD LENGTH=247	SoyBase	E_val: 8.00E-136	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0016595	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutamate binding	SoyBase	N/A	ISS
KOG2322	KOG	N-methyl-D-aspartate receptor glutamate-binding subunit	JGI		ISS
PTHR23291	Panther	BAX INHIBITOR-RELATED	JGI		ISS
PTHR23291:SF9	Panther	GLUTAMATE-/ASPARTATE-BINDING PEPTIDE-RELATED	JGI		ISS
PF01027	PFAM	Uncharacterised protein family UPF0005	JGI		ISS
UniRef100_C6T4L3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4L3_SOYBN	SoyBase	E_val: 1.00E-170	ISS
UniRef100_G7IDK0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BI1-like protein n=1 Tax=Medicago truncatula RepID=G7IDK0_MEDTR	SoyBase	E_val: 3.00E-154	ISS

Expression Patterns of Glyma10g03510

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g03510

Paralog	Evidence	Comments
Glyma02g16320	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g03510 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g029400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g03510

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g03510

Limit To All Plant Sequences

>Glyma10g03510.1   sequence type=CDS   gene model=Glyma10g03510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGAACCAACCATTGGGAAAAACCGATTTGGAAAGCGGTTCTCGCCCGCTGTATCCGATGATGCTTGAGAGCCCCGAACTGCGCTGGTCTTTCATCAGAAAAGTATACTCCATAATCGCCATACAGTTGCTCGTAACCATCGTCGTCGGCGCCGTCGTCGTCACCGTCCGCCCAATCAGCGTCTTCTTCGCCACCACCGGCGCCGGATTGGCTCTCTACATCGTCCTCATCTTTGTCCCCTTCATCACATTGTGTCCACTTTACTACTACTCCCAGAAGCATCCCGTCAATTACTTGCTCCTAGCAGTTTTCACCGTGTCTCTTGGTTTTGTCGTTGGATTGAGTTGCGCCTTTACTAGCGAGAAAGTTATTCTGGAAGCTGTCATATTGACTGCTGTGGTGGTGATTGCTCTAACACTCTACACATTTTGGGCTGCAAGGAGAGGCCATGATTTCAACTTCCTTGGACCCTTCTTGTTTGGTGCAGTGCTAGTTCTTATGGTCTTTGCTCTGATTCAGGTTCTGTTTCCACTGGGTAAATTGTCCGTGATGATCTATGGTTGCTTGGCAGCCATTATATTTTGCGGCTACATCATCTATGACACAGACAACCTGATCAAGAGATACTCGTACGATGAATACATTTGGGCTTCGATCTCCTTGTATCTGGACATCATTAACCTCTTCCTGTCTCTGCTCACTATTTTCAGAGCCGCTGATAGTTAG

Predicted protein sequences of Glyma10g03510

Limit To All Plant Sequences

>Glyma10g03510.1   sequence type=predicted peptide   gene model=Glyma10g03510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWNQPLGKTDLESGSRPLYPMMLESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFATTGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLAVFTVSLGFVVGLSCAFTSEKVILEAVILTAVVVIALTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVLFPLGKLSVMIYGCLAAIIFCGYIIYDTDNLIKRYSYDEYIWASISLYLDIINLFLSLLTIFRAADS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain