SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g03360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g03360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g03360

Feature Type:gene_model
Chromosome:Gm10
Start:2435083
stop:2436803
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g03360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G48130AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr2:19685263-19685977 REVERSE LENGTH=183 SoyBaseE_val: 3.00E-43ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_G7IDM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Medicago truncatula RepID=G7IDM7_MEDTR SoyBaseE_val: 1.00E-68ISS
UniRef100_I1L857UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L857_SOYBN SoyBaseE_val: 4.00E-125ISS

Expression Patterns of Glyma10g03360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g03360 not represented in the dataset
Glyma10g03360 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g03360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g028100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g03360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g03360
>Glyma10g03360.1   sequence type=CDS   gene model=Glyma10g03360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTTAGAGGGTTTGCCTTGTGTCTAGTTGCGGTCATAGTGGCCACTATGTGGAGTCAAAATGCTGCCCAATCGGGTTGCACCAATACACTAACAAGCTTAAGCCCTTGTCTGAACTACATAATGGGAAGTTCTTCAACCCCATCAGCTTCATGCTGCTCACAGCTCTCAAGCATAGTCCAATCTTCACCACAGTGCCTTTGCTCCGTGCTCAATGGTGGAGGTTCCACTTTTGGAATTACCATTAACCAAACTCTTGCTCTGTCTCTCCCTGGCGCTTGTGAAGTACAAACTCCCCCTGTTAGCCAGTGCCAAGCGGGCAATGGACCAACAACTCCTTCGACTGCTCCAGTTGGTTCTCCTTCTGGTTCTTCAGCTGAATCACCTCAAGGCTCAATTACTCCTTCTGCTTTAGACTTTCCCTCAGGTGCAGGATCTAAAACTGTGCCATCAATAGACGGTGGTTCATCTGATGGAAGCGCTATTAAAGTCCCCTTCCACTTGGTGCTCTATCTTCTTGCCCTTGTGTCTTGTGCCTTAACCTTCACCAAGTTCTGA
Predicted protein sequences of Glyma10g03360
>Glyma10g03360.1   sequence type=predicted peptide   gene model=Glyma10g03360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFRGFALCLVAVIVATMWSQNAAQSGCTNTLTSLSPCLNYIMGSSSTPSASCCSQLSSIVQSSPQCLCSVLNGGGSTFGITINQTLALSLPGACEVQTPPVSQCQAGNGPTTPSTAPVGSPSGSSAESPQGSITPSALDFPSGAGSKTVPSIDGGSSDGSAIKVPFHLVLYLLALVSCALTFTKF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo