Glyma10g03360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03360

Feature Type:	gene_model
Chromosome:	Gm10
Start:	2435083
stop:	2436803
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g03360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G48130	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr2:19685263-19685977 REVERSE LENGTH=183	SoyBase	E_val: 3.00E-43	ISS
GO:0000041	GO-bp	Annotation by Michelle Graham. GO Biological Process: transition metal ion transport	SoyBase	N/A	ISS
GO:0006826	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron ion transport	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0010106	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_G7IDM7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Medicago truncatula RepID=G7IDM7_MEDTR	SoyBase	E_val: 1.00E-68	ISS
UniRef100_I1L857	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L857_SOYBN	SoyBase	E_val: 4.00E-125	ISS

Expression Patterns of Glyma10g03360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g03360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g028100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g03360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g03360

Limit To All Plant Sequences

>Glyma10g03360.1   sequence type=CDS   gene model=Glyma10g03360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTTAGAGGGTTTGCCTTGTGTCTAGTTGCGGTCATAGTGGCCACTATGTGGAGTCAAAATGCTGCCCAATCGGGTTGCACCAATACACTAACAAGCTTAAGCCCTTGTCTGAACTACATAATGGGAAGTTCTTCAACCCCATCAGCTTCATGCTGCTCACAGCTCTCAAGCATAGTCCAATCTTCACCACAGTGCCTTTGCTCCGTGCTCAATGGTGGAGGTTCCACTTTTGGAATTACCATTAACCAAACTCTTGCTCTGTCTCTCCCTGGCGCTTGTGAAGTACAAACTCCCCCTGTTAGCCAGTGCCAAGCGGGCAATGGACCAACAACTCCTTCGACTGCTCCAGTTGGTTCTCCTTCTGGTTCTTCAGCTGAATCACCTCAAGGCTCAATTACTCCTTCTGCTTTAGACTTTCCCTCAGGTGCAGGATCTAAAACTGTGCCATCAATAGACGGTGGTTCATCTGATGGAAGCGCTATTAAAGTCCCCTTCCACTTGGTGCTCTATCTTCTTGCCCTTGTGTCTTGTGCCTTAACCTTCACCAAGTTCTGA

Predicted protein sequences of Glyma10g03360

Limit To All Plant Sequences

>Glyma10g03360.1   sequence type=predicted peptide   gene model=Glyma10g03360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFRGFALCLVAVIVATMWSQNAAQSGCTNTLTSLSPCLNYIMGSSSTPSASCCSQLSSIVQSSPQCLCSVLNGGGSTFGITINQTLALSLPGACEVQTPPVSQCQAGNGPTTPSTAPVGSPSGSSAESPQGSITPSALDFPSGAGSKTVPSIDGGSSDGSAIKVPFHLVLYLLALVSCALTFTKF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain