SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03091

Feature Type:gene_model
Chromosome:Gm10
Start:2213698
stop:2215271
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g03091
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03220AT Annotation by Michelle Graham. TAIR10: Eukaryotic aspartyl protease family protein | chr1:787143-788444 FORWARD LENGTH=433 SoyBaseE_val: 3.00E-102ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004190GO-mf Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity SoyBaseN/AISS
PTHR13683Panther ASPARTYL PROTEASES JGI ISS
PTHR13683:SF100Panther BASIC 7S GLOBULIN-RELATED JGI ISS
UniRef100_G7IEE7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan-specific endoglucanase inhibitor protein n=1 Tax=Medicago truncatula RepID=G7IEE7_MEDTR SoyBaseE_val: 3.00E-125ISS
UniRef100_UPI00018C6C6EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C6C6E related cluster n=1 Tax=unknown RepID=UPI00018C6C6E SoyBaseE_val: 8.00E-156ISS

Expression Patterns of Glyma10g03091
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g03091 not represented in the dataset
Glyma10g03091 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g03091 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g025600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g03091
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g03091
>Glyma10g03091.1   sequence type=CDS   gene model=Glyma10g03091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCGGCGAGCTCGCGGAAGACGTTGTTTCACTCCAATCCACCAACGGCTTCAACCCTAAGCAAAACGCCACCGTTTCACGATTTCTATTCGCCTGCGCCCCAACCTTCTTACTCCAAGGCCTCGCAACCGATGTCAGCGGCATGGCCGGTCTCGGCAGAACTAAAATCGCTCTCCCCTCGCAGTTCGCTTCCGCTTTCAGCTTCCGTAGAAAATTCGCCGTCTGCCTCTCGTCTTCAAACGGCGTCGCTTTCTTCGGTGACGGACCTTACGTTCTTCTCCCCAACGTCGATGCTTCTCAGCTACTCACCTTCACGCCGTTGTTACTAAACCCCGTTAGCACCGCTTCCGCTTTCGCCCTGGGAGAACCCTCCGCCGAGTATTTCATCGGCGTGAAATCGATTAAAATCGATGAAAAATCTGTGCGCGTTAACACTACTCTGTTGTCCATAAACAGCAGCGGCGTTGGCGGAACCAAGATCAGTTCCGTTAACCCTTACACTGTTTTGGAGGCTTCGATCTTCAAAGCGGTGACTGAGGCTTTTGTAAAAGCTTCTGCTGCTAGGAACATAACGAGGGTGGCTTCTGTGGCGCCATTTGAGGTGTGCTTCAGCAGTGAGAACGTGGTCGCCACGCGTTTGGGGGCGGCGGTGCCTACCATTGAGCTTGTGCTGCAGAATCAGAAGACGGTTTGGAGGATATATATTTGGAGCAAACTCGATGCCGAGGACTTGGATTGTAATTGGAAGACAATCTTTTGCATGGCTACTTCCAGATTGGGATTCAGCTCTTTGCTCTATGGAAGCCGAACTACGTGTTCTAACTTCTACTGTAGAATTTAA
Predicted protein sequences of Glyma10g03091
>Glyma10g03091.1   sequence type=predicted peptide   gene model=Glyma10g03091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCGELAEDVVSLQSTNGFNPKQNATVSRFLFACAPTFLLQGLATDVSGMAGLGRTKIALPSQFASAFSFRRKFAVCLSSSNGVAFFGDGPYVLLPNVDASQLLTFTPLLLNPVSTASAFALGEPSAEYFIGVKSIKIDEKSVRVNTTLLSINSSGVGGTKISSVNPYTVLEASIFKAVTEAFVKASAARNITRVASVAPFEVCFSSENVVATRLGAAVPTIELVLQNQKTVWRIYIWSKLDAEDLDCNWKTIFCMATSRLGFSSLLYGSRTTCSNFYCRI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo