Glyma10g03021 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g03021

Feature Type:	gene_model
Chromosome:	Gm10
Start:	2164055
stop:	2164877
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g03021

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63088	AT	Annotation by Michelle Graham. TAIR10: ROTUNDIFOLIA like 14 \| chr3:23313053-23313199 FORWARD LENGTH=48	SoyBase	E_val: 3.00E-11	ISS
PF08137	PFAM	DVL family	JGI		ISS
UniRef100_I1L820	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L820_SOYBN	SoyBase	E_val: 9.00E-24	ISS
UniRef100_Q6IM87	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DVL14 n=1 Tax=Arabidopsis thaliana RepID=Q6IM87_ARATH	SoyBase	E_val: 1.00E-08	ISS

Expression Patterns of Glyma10g03021

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g03021 not represented in the dataset	Glyma10g03021 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g03021 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g024900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g03021

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g03021

Limit To All Plant Sequences

>Glyma10g03021.1   sequence type=CDS   gene model=Glyma10g03021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTAATGTATTCTCAGTTAGAGGTTCTAAGGTTCGGTCATGGGAGAGGTGTTCCAAACAAGTTCGGCAGCAGAGGACAAGGCTTTACATAATTTGGAGATGCACTGTGTTACTCTTGTGCTGGCACGAGTAA

Predicted protein sequences of Glyma10g03021

Limit To All Plant Sequences

>Glyma10g03021.1   sequence type=predicted peptide   gene model=Glyma10g03021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAANVFSVRGSKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain