Report for Sequence Feature Glyma10g02860
Feature Type: gene_model
Chromosome: Gm10
Start: 2049691
stop: 2052368
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g02860
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G63030 AT
Annotation by Michelle Graham. TAIR10: methyl-CPG-binding domain 4 | chr3:23295394-23296425 FORWARD LENGTH=186
SoyBase E_val: 6.00E-69 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
GO:0008327 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyl-CpG binding
SoyBase N/A ISS
PTHR15547 Panther
ZN-FINGER/BROMODOMAIN CONTAINING PROTEIN
JGI ISS
PTHR15547:SF6 Panther
ZN-FINGER/BROMODOMAIN CONTAINING
JGI ISS
PF01429 PFAM
Methyl-CpG binding domain
JGI ISS
PF07496 PFAM
CW-type Zinc Finger
JGI ISS
UniRef100_A9PE20 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Methyl binding domain protein n=1 Tax=Populus trichocarpa RepID=A9PE20_POPTR
SoyBase E_val: 5.00E-70 ISS
UniRef100_I1L807 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L807_SOYBN
SoyBase E_val: 9.00E-126 ISS
Expression Patterns of Glyma10g02860
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma10g02860
Paralog Evidence Comments
Glyma02g16930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g02860 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g023600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g02860
Coding sequences of Glyma10g02860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g02860.1 sequence type=CDS gene model=Glyma10g02860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGGGCGGTCAAGAAATCTCAAAAACACCGTCCTCTTCTAAGAGAACACTAAGTCAGGGTTCAGTTGATATATATGCTGCTCAGTGCAAAAATTGCTTGAAATGGAGAGAGATTGATACACAGGAAGAGTTTGAAGAGATTAGAAGTAAAGTTGCTGAGGAACCTTTTCTTTGCAGCAGAAAGGCTAATAGTTCCTGTGATGAACCTGGTGATATTAAATATGATTCCTCTCGGACATGGGTGATTGACAAGCCTAACCTCCCAAAGACTCCACAAGGTTTTAAGAGGAGCTTGGTGCTTAGAAAAGATTACTCCAAATTGGACGCTTACTACATCACACCTGCAGGCAAAAAACTGAGAACCCGCAATGAGATTGCTGCGTTTCTAAAAGATAATCCAGAATTCAAAGGTGTGTCTGCTTCAGATTTTGATTTTTCTTCCCCAAAGATAATGCAAGACACCATCCCTGAGGTTGTTGAGCAGAAGGATTCTGCTAACAAGAAAGTTAAGATAGCCAAAGATGAGGTTTGA
Predicted protein sequences of Glyma10g02860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g02860.1 sequence type=predicted peptide gene model=Glyma10g02860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKGGQEISKTPSSSKRTLSQGSVDIYAAQCKNCLKWREIDTQEEFEEIRSKVAEEPFLCSRKANSSCDEPGDIKYDSSRTWVIDKPNLPKTPQGFKRSLVLRKDYSKLDAYYITPAGKKLRTRNEIAAFLKDNPEFKGVSASDFDFSSPKIMQDTIPEVVEQKDSANKKVKIAKDEV*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
