Glyma10g02590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02590

Feature Type:	gene_model
Chromosome:	Gm10
Start:	1818252
stop:	1819063
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g02590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62930	AT	Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein \| chr3:23261538-23261846 REVERSE LENGTH=102	SoyBase	E_val: 7.00E-45	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0048653	GO-bp	Annotation by Michelle Graham. GO Biological Process: anther development	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0008794	GO-mf	Annotation by Michelle Graham. GO Molecular Function: arsenate reductase (glutaredoxin) activity	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
KOG1752	KOG	Glutaredoxin and related proteins	JGI		ISS
PTHR10168	Panther	GLUTAREDOXIN	JGI		ISS
PF00462	PFAM	Glutaredoxin	JGI		ISS
UniRef100_E9NZU1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin n=1 Tax=Phaseolus vulgaris RepID=E9NZU1_PHAVU	SoyBase	E_val: 1.00E-61	ISS
UniRef100_I1L7X8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7X8_SOYBN	SoyBase	E_val: 7.00E-69	ISS

Expression Patterns of Glyma10g02590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g02590

Paralog	Evidence	Comments
Glyma02g17210	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g02590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g021100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g02590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g02590

Limit To All Plant Sequences

>Glyma10g02590.1   sequence type=CDS   gene model=Glyma10g02590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCTAATCACTAGTATGGTAGCTGAAAGGCCTGTGGTGATCTTCAGCAAGAGCACATGTTGCTTGAGCCACTCCATGACCACACTGATACGTAGCTTTGGTGCAAACCCTACTATTTATGAGCTTGATGAAATGACAAATGGGCAACCGATTGAAAGTGCGCTGCTTCAAATGGGGTGCCAGCCAAGTGTACCAGCTGTTTTTATAGGACAAAAATTCATTGGTGGATCTAAAAGGGTCATGAGTCTGCACCTTAGAAATGAGTTGGTGCCACTGCTCATAAATGCCAGGGCTATATGGATTTGA

Predicted protein sequences of Glyma10g02590

Limit To All Plant Sequences

>Glyma10g02590.1   sequence type=predicted peptide   gene model=Glyma10g02590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLITSMVAERPVVIFSKSTCCLSHSMTTLIRSFGANPTIYELDEMTNGQPIESALLQMGCQPSVPAVFIGQKFIGGSKRVMSLHLRNELVPLLINARAIWI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain