SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02570

Feature Type:gene_model
Chromosome:Gm10
Start:1804503
stop:1805766
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g02570
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03020AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr1:698207-698515 REVERSE LENGTH=102 SoyBaseE_val: 8.00E-43ISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0008794GO-mf Annotation by Michelle Graham. GO Molecular Function: arsenate reductase (glutaredoxin) activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG1752 KOG Glutaredoxin and related proteins JGI ISS
PTHR10168Panther GLUTAREDOXIN JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_G7KRS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin n=1 Tax=Medicago truncatula RepID=G7KRS2_MEDTR SoyBaseE_val: 3.00E-50ISS
UniRef100_I1L7X6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7X6_SOYBN SoyBaseE_val: 1.00E-69ISS

Expression Patterns of Glyma10g02570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g02570 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g020900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g02570
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g02570
>Glyma10g02570.1   sequence type=CDS   gene model=Glyma10g02570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTTGCTGGCAACTTTGACTGCTGACAAGCCAGTGGTGATCTTCAGCAAGAGCACTTGTGCCATTAGCCATTCTGTGAAAGCTCTCATATGCAGCTTTGGTGCCAACCCTACGGTTATCGAGATTGACAAAATGACAAATGGTCAGCAAATAGAGAGGGCACTGATTCAGGTTGGTTGCCGCCCAACTGTACCAGCAGTGTTCATTGGACAACAACTTATAGGTGGTGCTGACGAAGTCATATGCCTCAACGTCCAAAACAGGCTTGCCCAGTTGCTTTTGAGGGCTAGAGCTATATTTATCTGGAGTTCATAG
Predicted protein sequences of Glyma10g02570
>Glyma10g02570.1   sequence type=predicted peptide   gene model=Glyma10g02570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLLATLTADKPVVIFSKSTCAISHSVKALICSFGANPTVIEIDKMTNGQQIERALIQVGCRPTVPAVFIGQQLIGGADEVICLNVQNRLAQLLLRARAIFIWSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo