Report for Sequence Feature Glyma10g02480
Feature Type: gene_model
Chromosome: Gm10
Start: 1745512
stop: 1746297
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g02480
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G47810 AT
Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit B5 | chr2:19582938-19583420 REVERSE LENGTH=160
SoyBase E_val: 1.00E-58 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
PTHR11064 Panther
TATA-BINDING PROTEIN-ASSOCIATED PHOSPHOPROTEIN
JGI ISS
PTHR11064:SF9 Panther
CCAAT-BINDING TRANSCRIPTION FACTOR SUBUNIT A
JGI ISS
PF00808 PFAM
Histone-like transcription factor (CBF/NF-Y) and archaeal histone
JGI ISS
UniRef100_I1L7X0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7X0_SOYBN
SoyBase E_val: 3.00E-103 ISS
UniRef100_I3TAW4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit B6 n=1 Tax=Medicago truncatula RepID=I3TAW4_MEDTR
SoyBase E_val: 2.00E-66 ISS
Expression Patterns of Glyma10g02480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g02480
Paralog Evidence Comments
Glyma02g17310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g02480 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g020100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g02480
Coding sequences of Glyma10g02480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g02480.1 sequence type=CDS gene model=Glyma10g02480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTGACAACATAGGCAAAGTCTTAGACAGAGAAGGCTTTAAGTACAACTTCACAGCTTCAGCAAGTGGCACATCTGCACAAGATGGGGTGATTAAGGAGCAAGATCGGTTGCTTCCAATAGCTAATGTGGGGCGCATCATGAAGCAAATCCTTCCTCCCAACGCCAAGATCTCAAAGGAAGCTAAAGAAACCATGCAAGAAAGTGTGTCCGAGTTCATTAGCTTTGTCACTGGGGAAGCTTCTGACAAGTGTCACAAGGAGAAGCGCAAGACCGTGAATGGTGACGATATTTGCTGGGCCCTTGCTACTTTAGGGTTTGATGACTACTCTGAGCCACTTAAAAGGTACTTGTATAAGTATAGGGAGATGGAGGGGGAGAGAGCAAATCAAAATAAGGGTAGCAATGGTTATGAAAACAACATTGCAAACATATAA
Predicted protein sequences of Glyma10g02480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g02480.1 sequence type=predicted peptide gene model=Glyma10g02480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGDNIGKVLDREGFKYNFTASASGTSAQDGVIKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQESVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYSEPLKRYLYKYREMEGERANQNKGSNGYENNIANI*