Glyma10g02451 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02451

Feature Type:	gene_model
Chromosome:	Gm10
Start:	1722160
stop:	1723070
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g02451

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_C6T322	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T322_SOYBN	SoyBase	E_val: 3.00E-42	ISS

Expression Patterns of Glyma10g02451

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g02451 not represented in the dataset	Glyma10g02451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g02451

Paralog	Evidence	Comments
Glyma02g17351	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g02451 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g019800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g02451

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g02451

Limit To All Plant Sequences

>Glyma10g02451.1   sequence type=CDS   gene model=Glyma10g02451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATCTCACATCTCTGGTGAAAGCTCTCTGGGCAATGAGTTGAGGAGATCCGTCAGCGAGAAGCTTCATCACGTTGATGAGGCCGATGCTGCCAAGCAAGGTAGGGTTCTAAAGTATATACAAACTGAGAAGCGACGGAGGAGGAGCCACCGTGCAGAAGACCCCATAAGAACCTTGATGTTCTTAGGCTCTATGAATCACACGTGA

Predicted protein sequences of Glyma10g02451

Limit To All Plant Sequences

>Glyma10g02451.1   sequence type=predicted peptide   gene model=Glyma10g02451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSHISGESSLGNELRRSVSEKLHHVDEADAAKQGRVLKYIQTEKRRRRSHRAEDPIRTLMFLGSMNHT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain