SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02380

Feature Type:gene_model
Chromosome:Gm10
Start:1648222
stop:1650805
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g02380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G27720AT Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein | chr5:9815904-9817304 FORWARD LENGTH=129 SoyBaseE_val: 2.00E-62ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005732GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3293 KOG Small nuclear ribonucleoprotein (snRNP) JGI ISS
PTHR23338Panther SMALL NUCLEAR RIBONUCLEOPROTEIN SM JGI ISS
PF01423PFAM LSM domain JGI ISS
UniRef100_Q43582UniRef Annotation by Michelle Graham. Most informative UniRef hit: Probable U6 snRNA-associated Sm-like protein LSm4 n=1 Tax=Nicotiana tabacum RepID=LSM4_TOBAC SoyBaseE_val: 5.00E-75ISS
UniRef100_Q43582UniRef Annotation by Michelle Graham. Best UniRef hit: Probable U6 snRNA-associated Sm-like protein LSm4 n=1 Tax=Nicotiana tabacum RepID=LSM4_TOBAC SoyBaseE_val: 5.00E-75ISS

Expression Patterns of Glyma10g02380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g02380
ParalogEvidenceComments
Glyma02g17430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g02380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g019100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g02380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g02380
>Glyma10g02380.1   sequence type=CDS   gene model=Glyma10g02380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGCCCCTTTCCCTTCTCAAGACTGCCCAAGGCCACCCTATGCTAGTGGAACTGAAAAATGGGGAGACTTATAACGGGCACTTGGTTAATTGTGATACATGGATGAACATTCATCTCCGAGAAGTCATTTGTACCTCTAAAGATGGAGATAGATTTTGGCGTATGCCCGAGTGCTACATTCGCGGCAATACCATAAAGTACCTTCGGGTTCCTGATGAGGTTATTGACAAAGTCCAGGAAGAAACAAAGAGCCGCACTGATCGCAAACCCCCTGGTGTGGGACGTGGAAGAGGAAGAGGTAGGGAGGATGGTCCTGGTGGACGTCAACCAAAAGGAATTGGGCGTGGCCTTGATGAAGGTGGACCTAAAGGACAAGGAGGACGAGGTAGGGGTGGTCCCGGTGGAAAGCCTGGTGGAAACAGAGGTGGAGGGCGAGGTAGAGGTTGA
Predicted protein sequences of Glyma10g02380
>Glyma10g02380.1   sequence type=predicted peptide   gene model=Glyma10g02380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRTDRKPPGVGRGRGRGREDGPGGRQPKGIGRGLDEGGPKGQGGRGRGGPGGKPGGNRGGGRGRG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo