Glyma10g02310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02310

Feature Type:	gene_model
Chromosome:	Gm10
Start:	1610605
stop:	1611685
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g02310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62810	AT	Annotation by Michelle Graham. TAIR10: complex 1 family protein / LVR family protein \| chr3:23227763-23228180 FORWARD LENGTH=106	SoyBase	E_val: 1.00E-38	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
KOG3801	KOG	Uncharacterized conserved protein BCN92	JGI		ISS
PF05347	PFAM	Complex 1 protein (LYR family)	JGI		ISS
UniRef100_B9SAR4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Catalytic, putative n=1 Tax=Ricinus communis RepID=B9SAR4_RICCO	SoyBase	E_val: 2.00E-42	ISS
UniRef100_C6SWM9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWM9_SOYBN	SoyBase	E_val: 5.00E-71	ISS

Expression Patterns of Glyma10g02310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g02310

Paralog	Evidence	Comments
Glyma02g02180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g02310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g018500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g02310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g02310

Limit To All Plant Sequences

>Glyma10g02310.1   sequence type=CDS   gene model=Glyma10g02310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAGAGGGCAAGTTCTGAGCGCGTACCGCGCGCTTCTGAAAGCGACACGGAAAACATTTTCCGGCGACACCATGATGCTGAAGGAATCTGCGGTGGAAGTAAGGAAGAAGTTCGAGGAAAACAAGAACGTGAGCTCCGAGGCGGAGATCCAGAAGCTTCTCCTAGAGGCTGAAGAGGCCTCCCATTTCATCACCAACATGCTCGTCCAGGCACAGCTCAATCCCGATTCTGGCACTTACGCGGTGAAGCCGTGTAAGGAGCATGCTGGAGCAACGCTTGAACTTCCCTCCGAAGAAATTATTCGGAAGTCAGCATAG

Predicted protein sequences of Glyma10g02310

Limit To All Plant Sequences

>Glyma10g02310.1   sequence type=predicted peptide   gene model=Glyma10g02310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGQVLSAYRALLKATRKTFSGDTMMLKESAVEVRKKFEENKNVSSEAEIQKLLLEAEEASHFITNMLVQAQLNPDSGTYAVKPCKEHAGATLELPSEEIIRKSA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain