Report for Sequence Feature Glyma10g02210
Feature Type: gene_model
Chromosome: Gm10
Start: 1533205
stop: 1534729
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g02210
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G02820 AT
Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant 3 (LEA3) family protein | chr1:623933-624304 REVERSE LENGTH=91
SoyBase E_val: 2.00E-19 ISS
GO:0009790 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF03242 PFAM
Late embryogenesis abundant protein
JGI ISS
UniRef100_C6SZ33 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ33_SOYBN
SoyBase E_val: 7.00E-62 ISS
UniRef100_P32292 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Indole-3-acetic acid-induced protein ARG2 n=1 Tax=Vigna radiata var. radiata RepID=ARG2_VIGRR
SoyBase E_val: 6.00E-40 ISS
Expression Patterns of Glyma10g02210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g02210
Paralog Evidence Comments
Glyma02g02070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g02210 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g017600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g02210
Coding sequences of Glyma10g02210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g02210.1 sequence type=CDS gene model=Glyma10g02210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCGCTCTTTCTCCAACCTCAAGGTTCTCTCTGCTCTTGTCGCCGACGGATTCTCCAACACTCTCACCAGGCGTGGGTACGCAGTAGCGACACAAAGCGCAACAAGAGGAGGAGCAGCCTCCATCAGCGGCAAGTCAGGGGAAGACAAGGTACTAGGAGGAGGTGCTGAAAAGGTTTCGTGGGTCCCAGACCCTGTCACTGGTTACTACAAACCGGAGAACATCAAAGAGATTGATGTTGCTGAGCTGAGAGCCACGGTTTTGGGCAAAAAATTCAACCACTAG
Predicted protein sequences of Glyma10g02210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g02210.1 sequence type=predicted peptide gene model=Glyma10g02210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MARSFSNLKVLSALVADGFSNTLTRRGYAVATQSATRGGAASISGKSGEDKVLGGGAEKVSWVPDPVTGYYKPENIKEIDVAELRATVLGKKFNH*