SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02190

Feature Type:gene_model
Chromosome:Gm10
Start:1526975
stop:1528067
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g02190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02816AT Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF538 | chr1:621637-622137 FORWARD LENGTH=166 SoyBaseE_val: 6.00E-58ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04398PFAM Protein of unknown function, DUF538 JGI ISS
UniRef100_I1L7U2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7U2_SOYBN SoyBaseE_val: 1.00E-110ISS
UniRef100_Q9SRX5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F22D16.19 protein n=2 Tax=Arabidopsis thaliana RepID=Q9SRX5_ARATH SoyBaseE_val: 3.00E-55ISS

Expression Patterns of Glyma10g02190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g02190
ParalogEvidenceComments
Glyma02g02060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g02190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g017500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g02190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g02190
>Glyma10g02190.1   sequence type=CDS   gene model=Glyma10g02190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCATCACCACCTTCCTTCTCCTCCTCCTCCTCTCGCCGGCGATCACCGCCACCCCGACGGCGTACGAGATGCTGGAGAGCTTTCACTTTCCGGCGGGTATTCTCCCCAAGGGAGTGACCGGTTACGAGCTGGATCCGTCCAGCGGCAAATTCAGCGCCGATCTGAACGGTTCGTGCAGTTTCTCCCTCGAAGGTTCGTACCAGTTGAGCTACCAGAAAACCATCACCGGCTACGTATCCGAAGGCAGGCTCACCGAACTCCGCGGGATTAGCGTGAAGATCCTCTTCTTCTGGCTCAACATTCTCGACGTCGTTCGCGTCGGCGAAGACCTCGATTTCTCCGTCGGCGTCGCCTCCGCTTCCTTTCCCCTCGATAACTTCTTCGTCTCCCCGCAGTGTGGTTGCGGCTTGGATTGCGATGATTTTCGAATTAGGAAACTCGATTTGGGAAACCGAAAACCCTCCCTTTCCTCTGTGTAG
Predicted protein sequences of Glyma10g02190
>Glyma10g02190.1   sequence type=predicted peptide   gene model=Glyma10g02190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSITTFLLLLLLSPAITATPTAYEMLESFHFPAGILPKGVTGYELDPSSGKFSADLNGSCSFSLEGSYQLSYQKTITGYVSEGRLTELRGISVKILFFWLNILDVVRVGEDLDFSVGVASASFPLDNFFVSPQCGCGLDCDDFRIRKLDLGNRKPSLSSV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo