SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g02090

Feature Type:gene_model
Chromosome:Gm10
Start:1477331
stop:1478771
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g02090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47540AT Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr2:19505901-19506504 FORWARD LENGTH=173 SoyBaseE_val: 1.00E-47ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_E0A235UniRef Annotation by Michelle Graham. Most informative UniRef hit: Drought resistance protein n=1 Tax=Glycine max RepID=E0A235_SOYBN SoyBaseE_val: 1.00E-144ISS
UniRef100_I1L7T4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L7T4_SOYBN SoyBaseE_val: 2.00E-146ISS

Expression Patterns of Glyma10g02090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g02090
ParalogEvidenceComments
Glyma02g01970 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g02090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g016600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g02090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g02090
>Glyma10g02090.2   sequence type=CDS   gene model=Glyma10g02090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTCCTTCGATCCACCTTGGCGACCTCAATGGTTCTTTTAGCAATGCTAGCCATTGTCTCCGCAACTGACTATTATGGATATGGTCCAACACCAAAGCTTGAGAACCCCAAACCCAAAACAGATTACAAAGTTGACAAACCACACCCCAGAATACCAGATTACTATGCAGTGCCCAAACCAAAAGGAAACGATGAACTACATCTGCTTCCCACAATCATTGGTGTCCAAGGTGTTGTTTTATGTAAATCGGGTTCCAATTATTTCCCAATTCAAGGAGCGGTTGCAAGAGTTACATGTGGATGGGAGAATGAGCTTGGGTACGAGACAGGTCCTATATCAGTGTTGAGTCATGTGACAGATAGTAAAGGCTATTTCTTTGCTACATTGTCACTTGGGGAGCTTGGATCGAAATTGAAGATCACTGAGTGCAAGGCATACTTGGAGAGTTCTCCATTGGAGACATGTAAAGTTCCCACCGATGTCAACTACGGGATCAGTGGTGCTCGTCTTTCTTCTTATCGCCTCCTTGAGAATAAGATGAAGTTGTACACTGTGGGACCTTTCTTCTGCACCTCCCAACCTGCTAAACCACTCCCTAACGGTTATTAA
Predicted protein sequences of Glyma10g02090
>Glyma10g02090.2   sequence type=predicted peptide   gene model=Glyma10g02090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFLRSTLATSMVLLAMLAIVSATDYYGYGPTPKLENPKPKTDYKVDKPHPRIPDYYAVPKPKGNDELHLLPTIIGVQGVVLCKSGSNYFPIQGAVARVTCGWENELGYETGPISVLSHVTDSKGYFFATLSLGELGSKLKITECKAYLESSPLETCKVPTDVNYGISGARLSSYRLLENKMKLYTVGPFFCTSQPAKPLPNGY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo