SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g01940

Feature Type:gene_model
Chromosome:Gm10
Start:1373371
stop:1374910
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g01940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30620AT Annotation by Michelle Graham. TAIR10: winged-helix DNA-binding transcription factor family protein | chr2:13045360-13046267 FORWARD LENGTH=202 SoyBaseE_val: 3.00E-19ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PTHR11467Panther HISTONE H1/H5 JGI ISS
PF00538PFAM linker histone H1 and H5 family JGI ISS
UniRef100_B9RNJ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone h1/h5, putative n=1 Tax=Ricinus communis RepID=B9RNJ1_RICCO SoyBaseE_val: 8.00E-24ISS
UniRef100_I1L7S4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7S4_SOYBN SoyBaseE_val: 4.00E-86ISS

Expression Patterns of Glyma10g01940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g01940
ParalogEvidenceComments
Glyma02g01860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g01940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g015700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g01940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g01940
>Glyma10g01940.2   sequence type=CDS   gene model=Glyma10g01940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACAGATGTGAAGTGAAAAAGTTGCAAGTTCCAGAAAAATCGGAAAGAGTGGAGAACATGAAAAAATGTCAAAAGAAAATGCGAAGAACAAATCTCCCTCGTCCTTTGTTTTTTGTGATAGCCGATGCAATATCGTCGTTGAAAGAATGCAAGGGGTCGAGCCAGCCAGCAATAGCCAAGTTCATCGAGGACAAGCACACCAAAGTGCTCCCTCCCAATTTCCGGAAACTTCTCTCCGTTCAGTTGAAGAAACTCGTCAAATCGGAGAAGCTTTACAAGGTCAAAAACTTCTACAAGCTTTCTTCCGCCACGGATAAACAGACCCAGAAGAGTACCGAAACCGAGCCCAAACAGAAGGTGGGTGAGAAGGCTAAAAGATTGAGTCAAGTGAAGACACACGAAGCTCTCAAGAAGAAAGCACCGACCAAGAAGGACGCGGCGGCGGCGGTGGATGCCTCGTGA
Predicted protein sequences of Glyma10g01940
>Glyma10g01940.2   sequence type=predicted peptide   gene model=Glyma10g01940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYRCEVKKLQVPEKSERVENMKKCQKKMRRTNLPRPLFFVIADAISSLKECKGSSQPAIAKFIEDKHTKVLPPNFRKLLSVQLKKLVKSEKLYKVKNFYKLSSATDKQTQKSTETEPKQKVGEKAKRLSQVKTHEALKKKAPTKKDAAAAVDAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo