SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g01901

Feature Type:gene_model
Chromosome:Gm10
Start:1361228
stop:1364081
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g01901
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77670AT Annotation by Michelle Graham. TAIR10: Pyridoxal phosphate (PLP)-dependent transferases superfamily protein | chr1:29189043-29190901 REVERSE LENGTH=440 SoyBaseE_val: 2.00E-58ISS
GO:0006530GO-bp Annotation by Michelle Graham. GO Biological Process: asparagine catabolic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0019465GO-bp Annotation by Michelle Graham. GO Biological Process: aspartate transamidation SoyBaseN/AISS
GO:0019554GO-bp Annotation by Michelle Graham. GO Biological Process: glutamate catabolic process to oxaloacetate SoyBaseN/AISS
GO:0042218GO-bp Annotation by Michelle Graham. GO Biological Process: 1-aminocyclopropane-1-carboxylate biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008483GO-mf Annotation by Michelle Graham. GO Molecular Function: transaminase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016847GO-mf Annotation by Michelle Graham. GO Molecular Function: 1-aminocyclopropane-1-carboxylate synthase activity SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
KOG0257 KOG Kynurenine aminotransferase, glutamine transaminase K JGI ISS
PTHR11751Panther SUBGROUP I AMINOTRANSFERASE RELATED JGI ISS
PTHR11751:SF196Panther OS10G0484700 PROTEIN JGI ISS
PF00155PFAM Aminotransferase class I and II JGI ISS
UniRef100_G7IEH9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Kynurenine-oxoglutarate transaminase n=1 Tax=Medicago truncatula RepID=G7IEH9_MEDTR SoyBaseE_val: 2.00E-146ISS
UniRef100_UPI000233C4FAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C4FA related cluster n=1 Tax=unknown RepID=UPI000233C4FA SoyBaseE_val: 0ISS

Expression Patterns of Glyma10g01901
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g01901 not represented in the dataset
Glyma10g01901 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g01901
ParalogEvidenceComments
Glyma02g01830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g01901 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g015400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g01901
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g01901
>Glyma10g01901.1   sequence type=CDS   gene model=Glyma10g01901   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGGTTTAGACATCGACCCTCTTAAGGACGTAGCTATTTGCTGCGGTCAAAGCGAGGCATTTGCAGCTGCAATCTTTGCAACACTTGACCCGGGAGACGAAGTCATACTTTTCGACCCTTCCTATGAAACGTATGAAGGATGTGTTGTCATGACCGGGGGAATTCACGTGCCACTTGACCCGCCTCAATGGACACTGGATTCAAGCAAATTACCCAGATCATTTACTGAGAAAACTAAAGCCATAGTCCTGAACAGCCGGAATTTCCTGGCTATAACAGATGAAGTATACGAGCATATAACGTATGACAACCTAAAACATATATCCCTGGCCTCATTTCCTGGAATGCAAGAGCGGACAATTATAACGTCTTCTTTGCCAAAATCATTCAGTGTCACAGGTTGGAGAGTTGGATGGGCAATTGCACCAGCTTTTCTTGCGTCTGCTATCAGAAATATTGACGGAAGGGTTACAGATTATGCTCCAGCACCTTTTCAGGAAGCTGCATTGACTGCTTTGAGAAGTCCCCCTGAATACTTTGAATCACTCAGAAGGGACTATCAATCAAAAAGAGACTATATCATCAAGTTGCTAGGTGGAGTAGGTTTTAAAATAGAGTTTATACCTCAGGATTCCTTCTTCTTATTTGCTGAGCTTCCTGATAATTGCCCTCTTTCAGATGTAGAATTTGTTAAGAAGCTAATACTAGAAGCAGGGGTAGTGGCTGTTCCAGGACAAGGATTTTTTCATACAAACTTATCATCAAATGAAGTTTCTAACTTAAACTATCAGAAGAGATACGTCAGGTTTGCTTTCTGCTAG
Predicted protein sequences of Glyma10g01901
>Glyma10g01901.1   sequence type=predicted peptide   gene model=Glyma10g01901   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHGLDIDPLKDVAICCGQSEAFAAAIFATLDPGDEVILFDPSYETYEGCVVMTGGIHVPLDPPQWTLDSSKLPRSFTEKTKAIVLNSRNFLAITDEVYEHITYDNLKHISLASFPGMQERTIITSSLPKSFSVTGWRVGWAIAPAFLASAIRNIDGRVTDYAPAPFQEAALTALRSPPEYFESLRRDYQSKRDYIIKLLGGVGFKIEFIPQDSFFLFAELPDNCPLSDVEFVKKLILEAGVVAVPGQGFFHTNLSSNEVSNLNYQKRYVRFAFC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo