Glyma10g01870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g01870

Feature Type:	gene_model
Chromosome:	Gm10
Start:	1345548
stop:	1346172
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g01870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47480	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) \| chr2:19484207-19484539 REVERSE LENGTH=110	SoyBase	E_val: 9.00E-17	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF12023	PFAM	Domain of unknown function (DUF3511)	JGI		ISS
UniRef100_I1L7S0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7S0_SOYBN	SoyBase	E_val: 6.00E-61	ISS
UniRef100_Q10MM9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10MM9_ORYSJ	SoyBase	E_val: 1.00E-12	ISS

Expression Patterns of Glyma10g01870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g01870

Paralog	Evidence	Comments
Glyma02g01800	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g01870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g015200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g01870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g01870

Limit To All Plant Sequences

>Glyma10g01870.1   sequence type=CDS   gene model=Glyma10g01870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTACGGGTCGGGTCAGCGTCGGGTTGAGATAGTGAGCGGGAAAAGCTACGGCTGTAGTCAGAGCTACATGGCGGCGATTCCGAGCGAGGTGACTCGGGCGAGTCACAGCGGAGCAGCTACGGCGGCGAAGCCTTGGAGTTTTGGTGGCCCAGAGTCAAGGCGGAGAAAGAGGATTGCCAAGTATAAGGTTTACGCGGTTGAGGGAAAGGTTAAGGCTACGCTCCGGGATGGGATCCGATGGATCAAACATACGTGTTCTCGGATCGTCCATGGATACTAG

Predicted protein sequences of Glyma10g01870

Limit To All Plant Sequences

>Glyma10g01870.1   sequence type=predicted peptide   gene model=Glyma10g01870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDYGSGQRRVEIVSGKSYGCSQSYMAAIPSEVTRASHSGAATAAKPWSFGGPESRRRKRIAKYKVYAVEGKVKATLRDGIRWIKHTCSRIVHGY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain