Glyma10g01820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g01820

Feature Type:	gene_model
Chromosome:	Gm10
Start:	1317503
stop:	1322473
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g01820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47470	AT	Annotation by Michelle Graham. TAIR10: thioredoxin family protein \| chr2:19481503-19483683 FORWARD LENGTH=361	SoyBase	E_val: 0	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006662	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process	SoyBase	N/A	ISS
GO:0009553	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac development	SoyBase	N/A	ISS
GO:0009567	GO-bp	Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0048868	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube development	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0003756	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
GO:0016853	GO-mf	Annotation by Michelle Graham. GO Molecular Function: isomerase activity	SoyBase	N/A	ISS
KOG0191	KOG	Thioredoxin/protein disulfide isomerase	JGI		ISS
PTHR18929	Panther	PROTEIN DISULFIDE ISOMERASE	JGI		ISS
PF00085	PFAM	Thioredoxin	JGI		ISS
PF07749	PFAM	Endoplasmic reticulum protein ERp29, C-terminal domain	JGI		ISS
UniRef100_I1L7R5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L7R5_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I7GEK3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase-like protein n=1 Tax=Glycine max RepID=I7GEK3_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma10g01820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g01820

Paralog	Evidence	Comments
Glyma02g01750	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g01820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g014700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g01820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g01820

Limit To All Plant Sequences

>Glyma10g01820.1   sequence type=CDS   gene model=Glyma10g01820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAGTATCAGATCTGGAGCAGGAGAATAGCGTTGGCAGCGTTTGCGTTTGCTCTGCTGTTCCAATCGGCCTCAGCAGACGACGTCGTTGTGCTCTCTGAAGATAACTTCGAGAAGGAAGTTGGTCAGGACAGAGGAGCTCTCGTTGAGTTCTATGCTCCTTGGTGTGGACACTGCAAAAAGCTTGCTCCAGAATATGAAAAGCTTGGTAGCAGCTTCAAGAAAGCCAAATCTGTTTTAATTGGCAAGGTTGACTGTGATGAGCATAAGAGTTTGTGCAGCAAGTATGGAGTCTCTGGGTACCCAACAATTCAGTGGTTTCCAAAAGGATCTCTTGAAGCCAAAAAGTATGAAGGGCCACGCACTGCTGAATCACTTGTTGAGTTTGTAAATACGGAAGGAGGAACGAATGTAAAGATTGCTACAGTTCCTTCCAATGTAGTGGTGCTAACACCTGAAAATTTTAATGAGGTTGTCTTGGATGAAGCCAAAGATGTCTTGGTTGAGTTTTATGCACCATGGTGTGGACATTGCAAAAGTCTTGCTCCTACTTACGAGAAAGTTGCCACAGCATTTAAATTGGAGGAAGATGTAGTAATTGCAAATCTGGATGCTGATAAATATAGGGATCTGGCTGAAAAGTACGACGTGAGTGGATTTCCTACCTTGAAGTTCTTCCCAAAGGGCAACAAAGCTGGTGAAGACTACGGAGGTGGAAGAGACTTGGATGACTTTGTGGCTTTTATCAATGAGAAATCTGGAGCAAGTCGAGATGGAAAAGGACAACTTACTTCCCAAGCTGGTATAGTAGAAAGCTTGGATGTCTTGGTAAAGGAGTTTGTAGCTGCCAGCGATGAAGAGAAGAAATCCGTGTTTACCCGATTGGAAGAGGAAGTTGTGAAGCTTAAGGGTTCCGCCTCAAGGTACGGGAAGATTTACTTGAAAGCTGCCAAGAATTACAGGGAAAAAGGTTCTGATTATGCTAAGAACGAAATTCAGCGCCTACAGCGCATTCTTGACAAGTCCATTAGCCCTGCGAAGGCCGACGAGTTAACTCTAAAGAAAAATATCTTGTCGACATATGCTGCTTGA

Predicted protein sequences of Glyma10g01820

Limit To All Plant Sequences

>Glyma10g01820.1   sequence type=predicted peptide   gene model=Glyma10g01820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKYQIWSRRIALAAFAFALLFQSASADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEAKKYEGPRTAESLVEFVNTEGGTNVKIATVPSNVVVLTPENFNEVVLDEAKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGASRDGKGQLTSQAGIVESLDVLVKEFVAASDEEKKSVFTRLEEEVVKLKGSASRYGKIYLKAAKNYREKGSDYAKNEIQRLQRILDKSISPAKADELTLKKNILSTYAA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain