Report for Sequence Feature Glyma10g01600
Feature Type: gene_model
Chromosome: Gm10
Start: 1168376
stop: 1169960
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g01600
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G61310 AT
Annotation by Michelle Graham. TAIR10: Cytochrome c oxidase subunit Vc family protein | chr5:24653543-24653737 REVERSE LENGTH=64
SoyBase E_val: 1.00E-33 ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005746 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain
SoyBase N/A ISS
GO:0004129 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity
SoyBase N/A ISS
PF05799 PFAM
Cytochrome c oxidase subunit Vc (COX5C)
JGI ISS
UniRef100_G7IDQ0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase subunit 5C n=1 Tax=Medicago truncatula RepID=G7IDQ0_MEDTR
SoyBase E_val: 2.00E-35 ISS
UniRef100_I1L7P7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7P7_SOYBN
SoyBase E_val: 2.00E-38 ISS
Expression Patterns of Glyma10g01600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g01600
Paralog Evidence Comments
Glyma02g01570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g01600 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g012800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g01600
Coding sequences of Glyma10g01600
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g01600.1 sequence type=CDS gene model=Glyma10g01600 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGGTCCTAGGATTGCCCATGCTACCTTGAAAGGTCCGAGTGTGGTTAAGGAGATCATAATTGGAATAACACTTGGCTTAGCTGCTGGTGGTGTGTGGAAGATGCACCACTGGAATGAACAGAGGAAAACCAGGACCTTCTACGATTTACTGGAAAAGGGTGAGATTACTGTTGTTGCAGAGGAACAGTGA
Predicted protein sequences of Glyma10g01600
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g01600.1 sequence type=predicted peptide gene model=Glyma10g01600 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAGPRIAHATLKGPSVVKEIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEEQ*