Glyma10g01391 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g01391

Feature Type:	gene_model
Chromosome:	Gm10
Start:	1018230
stop:	1021331
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g01391

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G01935	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; Has 37 Blast hits to 37 proteins in 17 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 30; Viruses - 0; Other Eukaryotes - 7 (source: NCBI BLink). \| chr4:841102-842228 FORWARD LENGTH=256	SoyBase	E_val: 5.00E-31	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7ICU5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA methyltransferase 1-associated protein n=1 Tax=Medicago truncatula RepID=G7ICU5_MEDTR	SoyBase	E_val: 2.00E-34	ISS
UniRef100_I1JBD9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBD9_SOYBN	SoyBase	E_val: 1.00E-50	ISS

Expression Patterns of Glyma10g01391

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g01391 not represented in the dataset	Glyma10g01391 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g01391

Paralog	Evidence	Comments
Glyma02g01350	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g01391 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g01391

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g01391

Limit To All Plant Sequences

>Glyma10g01391.1   sequence type=CDS   gene model=Glyma10g01391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGATCACCAAGAAACAGAAAACGAACCAGCCCAAAGAGACCGTATCTAAGGTGCATAGTGTCGTGAACGGGGACAGGGAGGACAGAATCGGGAGTCAGGTTCCACTCCACACAAACATTTGGCTTCCTTTCTTGCTGGGGTTATTTTATTCCTCTGTTGATTTGCTTCAACTCTACCTAGACGAAAAGGTCTCGAACAGGGTTCAAGAGGCAACTTTAGCAAAGACAATTCTCTCGCCAATGACATGGCCAGGTTTCACCTTGGCATGCATTGTTGGGCTTGGTTGCCCATTGGCTGAGGTTCCAATTATGAAGTTCTTCCACCTTTGGTACTATCCTCAAGCGAATATTGAAATCTTTGGCCAGGTACATGATATTACAATCAGTTCCCACTAA

Predicted protein sequences of Glyma10g01391

Limit To All Plant Sequences

>Glyma10g01391.1   sequence type=predicted peptide   gene model=Glyma10g01391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVITKKQKTNQPKETVSKVHSVVNGDREDRIGSQVPLHTNIWLPFLLGLFYSSVDLLQLYLDEKVSNRVQEATLAKTILSPMTWPGFTLACIVGLGCPLAEVPIMKFFHLWYYPQANIEIFGQVHDITISSH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain