Report for Sequence Feature Glyma10g01370
Feature Type: gene_model
Chromosome: Gm10
Start: 998637
stop: 999077
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g01370
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1L7M6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7M6_SOYBN
SoyBase E_val: 7.00E-41 ISS
Expression Patterns of Glyma10g01370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g01370
Paralog Evidence Comments
Glyma02g01320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g01370 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g010600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g01370
Coding sequences of Glyma10g01370
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g01370.1 sequence type=CDS gene model=Glyma10g01370 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTCAATCTTGCTATTACTAGAAGCCTTGATAAGATGTTGTCACCATGAACTTGTGCCACAGAGTCCAACGTGGAAAGAAAAAGAGACAAAAGACTTGACACACATTATTGAGGTGAAGAAACCAGCTGGGAAAGCATCCATAGGCATGGACAACCTTGATGGCTTCTGGAGTTTCTTCAGTGATCACATAGAGTAG
Predicted protein sequences of Glyma10g01370
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g01370.1 sequence type=predicted peptide gene model=Glyma10g01370 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASILLLLEALIRCCHHELVPQSPTWKEKETKDLTHIIEVKKPAGKASIGMDNLDGFWSFFSDHIE*