SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g01340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g01340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g01340

Feature Type:gene_model
Chromosome:Gm10
Start:988113
stop:989801
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47190AT Annotation by Michelle Graham. TAIR10: myb domain protein 2 | chr2:19376284-19377297 FORWARD LENGTH=273 SoyBaseE_val: 1.00E-77ISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0010260GO-bp Annotation by Michelle Graham. GO Biological Process: organ senescence SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0001046GO-mf Annotation by Michelle Graham. GO Molecular Function: core promoter sequence-specific DNA binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
KOG0048 KOG Transcription factor, Myb superfamily JGI ISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_I1L7M4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7M4_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q0PJK7UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB76 n=1 Tax=Glycine max RepID=Q0PJK7_SOYBN SoyBaseE_val: 8.00E-136ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g01340 not represented in the dataset

Glyma10g01340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g01300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g010400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g01340.1   sequence type=CDS   gene model=Glyma10g01340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATACGATCAGTGTTCAGGCGATGAGAAGCTTATCAGATAGTGACTCATTATCATCTGCAACATATGCAAGTGAAGAAGATATGAAAATTAAGAAAGGTCCATGGACTGAGGAAGAAGATTCTGTTCTGATCAACTACGTCAACTTCCAAGGCGAAGGTCAATGGAACTCCCTCGCTCGCTCTGCAGGTCTAAAGCGAACGGGCAAAAGCTGCAGACTGAGATGGTTGAACTATTTGCGACCAAATGTTCGACGTGGGAACATCACCCTTCAAGAACAGCTCTTGATTCTCGAACTCCATTCCCGCTGGGGCAATCGGTGGGCTAAAATAGCAGAAGAATTGGGTGGGAGAACAGACAATGAGATAAAGAACTATTGGAGGACTCGAGTGGTGAAGCAGGCCAAGCAACTCAAATGTGATGTAAACAGCAAACAGTTCAGGGACACGGTGCGTTTCGTTTGGATGCCGCGCCTTATGGAGCAGATTCAGGCTTCTTTCAGGATTGTTCCTTCAGATTCTTCCCATGGCCTTGATCAAACCACATTGTGCAACACTCAACAAACAGAATCTAGTACTGATGCCAATCCCACCATGTTTTGTGACAACTCAATGGTTTCATCGTACTCATCAGAGGTTGATCTTCAGCCTCTTTCTCTTTCTGATACAAGTACAACTTCATCATCGGAAAGTGCAGAGAAGAAGGAGTCCATATCCTCCTCCCTTTGGCAGCAATGGGACTACTCTGACCTCCAAGCATTTGAACCATGCAATGGTTTTGGTGATGCAGACTTGTGGACCGATGAAAACATATGGTTCTTGCAGCAGCATCTTGCTGATCACTTATGA

>Glyma10g01340.1   sequence type=predicted peptide   gene model=Glyma10g01340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDTISVQAMRSLSDSDSLSSATYASEEDMKIKKGPWTEEEDSVLINYVNFQGEGQWNSLARSAGLKRTGKSCRLRWLNYLRPNVRRGNITLQEQLLILELHSRWGNRWAKIAEELGGRTDNEIKNYWRTRVVKQAKQLKCDVNSKQFRDTVRFVWMPRLMEQIQASFRIVPSDSSHGLDQTTLCNTQQTESSTDANPTMFCDNSMVSSYSSEVDLQPLSLSDTSTTSSSESAEKKESISSSLWQQWDYSDLQAFEPCNGFGDADLWTDENIWFLQQHLADHL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo