Glyma10g01220 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g01220

Feature Type:	gene_model
Chromosome:	Gm10
Start:	901035
stop:	902201
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g01220

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G15580	AT	Annotation by Michelle Graham. TAIR10: Ubiquitin-like superfamily protein \| chr3:5274075-5275000 REVERSE LENGTH=115	SoyBase	E_val: 1.00E-57	ISS
GO:0006914	GO-bp	Annotation by Michelle Graham. GO Biological Process: autophagy	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005775	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar lumen	SoyBase	N/A	ISS
GO:0008017	GO-mf	Annotation by Michelle Graham. GO Molecular Function: microtubule binding	SoyBase	N/A	ISS
GO:0019776	GO-mf	Annotation by Michelle Graham. GO Molecular Function: Atg8 ligase activity	SoyBase	N/A	ISS
GO:0019779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: APG8 activating enzyme activity	SoyBase	N/A	ISS
GO:0019786	GO-mf	Annotation by Michelle Graham. GO Molecular Function: APG8-specific protease activity	SoyBase	N/A	ISS
KOG1654	KOG	Microtubule-associated anchor protein involved in autophagy and membrane trafficking	JGI		ISS
PTHR10969	Panther	MICROTUBULE-ASSOCIATED PROTEINS 1A/1B LIGHT CHAIN 3-RELATED	JGI		ISS
PTHR10969:SF4	Panther	MICROTUBULE-ASSOCIATED PROTEINS 1A/1B LIGHT CHAIN 3	JGI		ISS
PF02991	PFAM	Microtubule associated protein 1A/1B, light chain 3	JGI		ISS
UniRef100_B9A7M1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GmATG8i protein n=1 Tax=Glycine max RepID=B9A7M1_SOYBN	SoyBase	E_val: 9.00E-83	ISS
UniRef100_C6T418	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T418_SOYBN	SoyBase	E_val: 2.00E-84	ISS

Expression Patterns of Glyma10g01220

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g01220

Paralog	Evidence	Comments
Glyma02g01180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g01220 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g009300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g01220

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g01220

Limit To All Plant Sequences

>Glyma10g01220.1   sequence type=CDS   gene model=Glyma10g01220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGGAAATTCCAGTTTCAGGGATGAATATACCTTCGAACAAAGGCTTGGAGAATCGCGGGATATTGTGGCCAAATACCCCGATCGAGTCCCCGTGATTGTGGAAAGATATGCGAAATGCGATCTGCCTGAGTTGGAGAAGAAAAAATACCTTGTTCCTCGAGACTTGTCTGTTGGGCATTTCATTCATATTTTGAGTTCCAGACTGAGTCTGCCCCCTGGAAAAGCTCTCTTTGTATTTGTGAAGAATACTTTGCCTCAAACTGCTAATATGATGGACTCTGTGTATAGATCATTCAAGGATGAGGATGGATTTCTTTACATGTATTATAGCACCGAGAAAACCTTCGGTTCGTACATTATGTAA

Predicted protein sequences of Glyma10g01220

Limit To All Plant Sequences

>Glyma10g01220.1   sequence type=predicted peptide   gene model=Glyma10g01220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGNSSFRDEYTFEQRLGESRDIVAKYPDRVPVIVERYAKCDLPELEKKKYLVPRDLSVGHFIHILSSRLSLPPGKALFVFVKNTLPQTANMMDSVYRSFKDEDGFLYMYYSTEKTFGSYIM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain