Report for Sequence Feature Glyma10g00980
Feature Type: gene_model
Chromosome: Gm10
Start: 692186
stop: 693376
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g00980
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G23240 AT
Annotation by Michelle Graham. TAIR10: ethylene response factor 1 | chr3:8295705-8296361 FORWARD LENGTH=218
SoyBase E_val: 7.00E-60 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0006952 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009873 GO-bp
Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PF00847 PFAM
AP2 domain
JGI ISS
UniRef100_D8VD37 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ethylene response factor 10 n=1 Tax=Actinidia deliciosa RepID=D8VD37_ACTDE
SoyBase E_val: 4.00E-59 ISS
UniRef100_I1L7I1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7I1_SOYBN
SoyBase E_val: 4.00E-121 ISS
Expression Patterns of Glyma10g00980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g00980
Paralog Evidence Comments
Glyma02g00870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g00980 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g007000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g00980
Coding sequences of Glyma10g00980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g00980.1 sequence type=CDS gene model=Glyma10g00980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATAGTTCCTCTCATCAGCTCCTCCCCTTCAACGAAAACGACCCAGAAGACATGCTTCTCTATGGCATCATCACTTCATGCCAAGAAAAAAAAGTGACCATCAACCAAGAGCAAGTGAATAAGAAGAGGAGCAGCTTCCGCGGCGTGCGGAGGCGGCCGTGGGGGAAGTTCGCGGCGGAGATAAGAGACTCCACGCGGCATGGCGTGAGGGTGTGGCTTGGGACATTCGACAACGCCGAGGCCGCCGCGCTGGCGTATGACCAAGCCGCATTCTCCATGAGGGGCTCCGGCGCGGTGCTCAACTTCCCCGTGGAGAAGGTGAAGGAGTCTCTTAGAGACATGAAGCTTGATGGATGCTCTCCCGTTGTGGCCTTGAAGAGGAGACACTCCTTGGCTGCTAAGAGGAAGAAGGAAGATGTCCTTGTTTTCCATGACCTTGGGGCTGATTATTTGGAACACTTGTTGATGTGCTCTGATCTACCTAGTACAACCATTGTTTAA
Predicted protein sequences of Glyma10g00980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g00980.1 sequence type=predicted peptide gene model=Glyma10g00980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDSSSHQLLPFNENDPEDMLLYGIITSCQEKKVTINQEQVNKKRSSFRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDNAEAAALAYDQAAFSMRGSGAVLNFPVEKVKESLRDMKLDGCSPVVALKRRHSLAAKRKKEDVLVFHDLGADYLEHLLMCSDLPSTTIV*