Glyma10g00930 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g00930

Feature Type:	gene_model
Chromosome:	Gm10
Start:	647986
stop:	650332
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g00930

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G23250	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 15 \| chr3:8309492-8310624 FORWARD LENGTH=285	SoyBase	E_val: 7.00E-83	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0052542	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG0048	KOG	Transcription factor, Myb superfamily	JGI		ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_Q9S7E3	UniRef	Annotation by Michelle Graham. Best UniRef hit: GmMYB29A1 protein n=1 Tax=Glycine max RepID=Q9S7E3_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9S7E3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GmMYB29A1 protein n=1 Tax=Glycine max RepID=Q9S7E3_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma10g00930

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g00930

Paralog	Evidence	Comments
Glyma02g00820	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g00930 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g006600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g00930

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g00930

Limit To All Plant Sequences

>Glyma10g00930.1   sequence type=CDS   gene model=Glyma10g00930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTAGAGCTCCTTGTTGTGAAAAGATGGGATTGAAAAAGGGTCCTTGGACCCCAGAGGAAGATCAAATCCTCATGTCATACATCCAAAAACATGGCCATGGAAATTGGCGTGCCCTCCCAAAGCTTGCAGGACTATTGAGGTGTGGAAAGAGCTGCAGACTAAGGTGGATTAACTATCTAAGGCCTGATATCAAGAGAGGCAATTTCTCAAGTGAAGAAGAGGAAATTATCATTAAGATGCATGAGTTGCTGGGGAACAGGTGGTCAGCAATTGCAGCAAAATTACCAGGAAGAACTGACAATGAAATAAAAAATGTGTGGCACACCCACTTGAAAAAGAGGTTAATGAATTCAGATACCAACAAAAGGGTTTCCAAGCCAAGAATCAAACGATCTGATTCCAATTCCAGCACACTTACTCAATCAGAACCTACATCATCATCAGGATGCACTACTTCTAGTGATTTTTCATCATTTAGTGAAGGGACTAAAAACATGGACAACATGATCAAGAGGGAAGACATAGAGTCTATGGAGACAGTAAAGCCTCCAATTGATGAAAGCTTTTGGCCACAAGAAACAGTGGATTATGAAAGCTCCACCATGATGCAATCATCAAATTCTTGGACAATTTCTAATGAATTAGCACCCCCTCAATACCAATTTAATTCAGTGGAAACCTTTCAACAGCAAAGTGTTGGTTATAATGATTCAAAATTTGATGATGGCATGGATTTCTGGTATGACATATTCATCAAATCAGGAGAGTCAATCGAATTGCCAGAGTTCTGA

Predicted protein sequences of Glyma10g00930

Limit To All Plant Sequences

>Glyma10g00930.1   sequence type=predicted peptide   gene model=Glyma10g00930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINYLRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLMNSDTNKRVSKPRIKRSDSNSSTLTQSEPTSSSGCTTSSDFSSFSEGTKNMDNMIKREDIESMETVKPPIDESFWPQETVDYESSTMMQSSNSWTISNELAPPQYQFNSVETFQQQSVGYNDSKFDDGMDFWYDIFIKSGESIELPEF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain