SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g00910

Feature Type:gene_model
Chromosome:Gm10
Start:633731
stop:634969
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14380AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 22 Blast hits to 22 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 1; Plants - 18; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). | chr4:8285815-8286417 FORWARD LENGTH=200 SoyBaseE_val: 7.00E-24ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI000233C36CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C36C related cluster n=1 Tax=unknown RepID=UPI000233C36C SoyBaseE_val: 1.00E-161ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g00800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g006400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g00910.2   sequence type=CDS   gene model=Glyma10g00910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCACAAGAGGCTAGGAAAAAAGCTTCAACCTGCCAAGAAGGCATGGAAGAGCTTCTCCAACACAGTCCAACACAAACTCCACAAACTCAACATTCCCAATTCCATGAAAACCACCCTTCAACGCCTCCTTCAATCCTTTTACTCCCTTGGCACTGTCATACACTCTAGACTTCATCGTTCATTCACCACCATAAGGCCACGTGGTGGTACTGCCACTTCTAATTACTACCATGTTCAATACAAGCACTGTGCAGCCATACACATAGATGACCTATTTGACAACAAGACTAATAATTCTGCAGTGTCCGTGCATGCCACCAACAAGACAAGTGCTCCTCATGCAACACAAGTGCAAGGGGAAACAACCAAAGGCAAAGAGATCAAAGGGAAAGAGAAAGAGGAGCCTGGTATTTACAAGGGTAATAATTTGGTTGGTCAGTGTCGCAACCAGAGTCGCAGTGGCGGCGGCGAGGGTAGTAGTAGTGGCTTGAACACTATAGAGGATGCATGGAAGGTTGTGGTTGCCAAGTCTCCACAACTACATGTGGATCAAAAGGCAGAAGAATTCATAAGCAAGTTTCGTCAAGATATGAGGCTTCAGAAAGAGAGGTCAATGCTTGAATTCCAGGAGATGCTAGCACGCAGTACCTGA

>Glyma10g00910.2   sequence type=predicted peptide   gene model=Glyma10g00910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHKRLGKKLQPAKKAWKSFSNTVQHKLHKLNIPNSMKTTLQRLLQSFYSLGTVIHSRLHRSFTTIRPRGGTATSNYYHVQYKHCAAIHIDDLFDNKTNNSAVSVHATNKTSAPHATQVQGETTKGKEIKGKEKEEPGIYKGNNLVGQCRNQSRSGGGEGSSSGLNTIEDAWKVVVAKSPQLHVDQKAEEFISKFRQDMRLQKERSMLEFQEMLARST*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo