Glyma10g00860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g00860

Feature Type:	gene_model
Chromosome:	Gm10
Start:	599011
stop:	599558
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g00860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G24940	AT	Annotation by Michelle Graham. TAIR10: membrane-associated progesterone binding protein 2 \| chr2:10609447-10609749 FORWARD LENGTH=100	SoyBase	E_val: 2.00E-35	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR10281	Panther	MEMBRANE ASSOCIATED PROGESTERONE RECEPTOR-RELATED	JGI		ISS
PF00173	PFAM	Cytochrome b5-like Heme/Steroid binding domain	JGI		ISS
UniRef100_B9RNT1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Steroid binding protein, putative n=1 Tax=Ricinus communis RepID=B9RNT1_RICCO	SoyBase	E_val: 1.00E-33	ISS
UniRef100_I1L7G8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L7G8_SOYBN	SoyBase	E_val: 6.00E-45	ISS

Expression Patterns of Glyma10g00860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g00860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g005900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g00860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g00860

Limit To All Plant Sequences

>Glyma10g00860.1   sequence type=CDS   gene model=Glyma10g00860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGAGTGGGTCGTGTCTACGATGTCAGCACTGGAAAATCCTTTTACGGCCCCGGCGGCCCCTACGCCATGTTCGCCGGCAAAGACACCAGCAGAGCCCTGGCGAAGATGAGCAAGAACAACGACGACATCTCCCCCTCCCTCGTTGACCTCTCTAACAAGGAGATCGGCGTTCTCAACGACTGGGAGAACAAATTCCAAGCTAAGTACCCTGTGGTTGCTCGTGTTCTCAATTAA

Predicted protein sequences of Glyma10g00860

Limit To All Plant Sequences

>Glyma10g00860.1   sequence type=predicted peptide   gene model=Glyma10g00860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGVGRVYDVSTGKSFYGPGGPYAMFAGKDTSRALAKMSKNNDDISPSLVDLSNKEIGVLNDWENKFQAKYPVVARVLN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain