SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g00790

Feature Type:gene_model
Chromosome:Gm10
Start:529723
stop:533548
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g00790
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23490AT Annotation by Michelle Graham. TAIR10: cyanase | chr3:8423238-8424415 REVERSE LENGTH=168 SoyBaseE_val: 1.00E-84ISS
GO:0009439GO-bp Annotation by Michelle Graham. GO Biological Process: cyanate metabolic process SoyBaseN/AISS
GO:0009440GO-bp Annotation by Michelle Graham. GO Biological Process: cyanate catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008824GO-mf Annotation by Michelle Graham. GO Molecular Function: cyanate hydratase activity SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PF02560PFAM Cyanate lyase C-terminal domain JGI ISS
UniRef100_I1L7G1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyanate hydratase 2 n=1 Tax=Glycine max RepID=I1L7G1_SOYBN SoyBaseE_val: 1.00E-118ISS
UniRef100_I1L7G1UniRef Annotation by Michelle Graham. Best UniRef hit: Cyanate hydratase 2 n=1 Tax=Glycine max RepID=I1L7G1_SOYBN SoyBaseE_val: 1.00E-118ISS

Expression Patterns of Glyma10g00790
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g00790 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g005200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g00790
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g00790
>Glyma10g00790.1   sequence type=CDS   gene model=Glyma10g00790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCAGAAGAAGGCAAAGATAGTGGCAGAGCTCCAAGCTGTGAAGCACAACAGTGGCAAGTCCTACAATCAGTTAGCGGAGGAGACTGGACTCACCAACGTCTATGTTGCTCAGCTTCTCAGGAGACAGGCTCAGCTCAATCCCCAAACTGCCCCTCTACTTCGGGCAGCGCTGCCCGACCTGCCCCAAGACCTTGTTTCTGAGATGATGAGACCCCCTTTGAGGTCTTATGACCCTAATCTCATCCAAGACCCCACTGTCTATAGGTTGAATGAAGCTGTTATGCATTTTGGGGAGAGCATCAAAGAAATAATCAATGAGGAGTTTGGTGATGGGATCATGTCAGCAATAGATTTCTACTGCTCGGTTGATAAAATTAAAGGAGTAGATGGGAAGGATCGTGTGGTATTGACATTTGATGGGAAATATTTGCCACATTCAGAACAGAAATCTGAGCACATGGTTTCAAGAACAAGGCCACTGGGAAAACAGTGA
Predicted protein sequences of Glyma10g00790
>Glyma10g00790.1   sequence type=predicted peptide   gene model=Glyma10g00790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQKKAKIVAELQAVKHNSGKSYNQLAEETGLTNVYVAQLLRRQAQLNPQTAPLLRAALPDLPQDLVSEMMRPPLRSYDPNLIQDPTVYRLNEAVMHFGESIKEIINEEFGDGIMSAIDFYCSVDKIKGVDGKDRVVLTFDGKYLPHSEQKSEHMVSRTRPLGKQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo