SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g00701

Feature Type:gene_model
Chromosome:Gm10
Start:449239
stop:452709
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g00701
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G33460AT Annotation by Michelle Graham. TAIR10: ROP-interactive CRIB motif-containing protein 1 | chr2:14174590-14175561 REVERSE LENGTH=224 SoyBaseE_val: 3.00E-21ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010215GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose microfibril organization SoyBaseN/AISS
GO:0031122GO-bp Annotation by Michelle Graham. GO Biological Process: cytoplasmic microtubule organization SoyBaseN/AISS
GO:0010005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cortical microtubule, transverse to long axis SoyBaseN/AISS
GO:0016324GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apical plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00786PFAM P21-Rho-binding domain JGI ISS
UniRef100_G7IJK4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Desiccation-associated protein n=1 Tax=Medicago truncatula RepID=G7IJK4_MEDTR SoyBaseE_val: 4.00E-50ISS
UniRef100_UPI000233C217UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C217 related cluster n=1 Tax=unknown RepID=UPI000233C217 SoyBaseE_val: 4.00E-170ISS

Expression Patterns of Glyma10g00701
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g00701 not represented in the dataset
Glyma10g00701 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g00701
ParalogEvidenceComments
Glyma02g00660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g00701 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g004500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g00701
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g00701
>Glyma10g00701.1   sequence type=CDS   gene model=Glyma10g00701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACCACCACCAGCACCTTTTAATTAGTGGAAGGTTAATTAATTTCTGGTGTAAATATATCAACGAGCTTTATCTACATAAATTAATGCCGACCAAGGTGAAAGGCCTCCTTAAATACATATCCCAAATATTCGAAGAGAAAGAAGAAGAATTTCAAATTGGGTTGCCAACTGATGTAAGGCATGTGGCACATATTGGATCAGATGATCCATCTGCAAATGCACCAAGCTGGATGAACGATATCAAACGAGGAAAAGAACCCCCATCAGGAAACCCTACTCAGACAGTTGAAGAATGTGAGAAAAAGTCATCATCAAATTCCAAACGTTCCAAAATCCGCAACCACCTGATTCCCAAGTCCCGACACACTTCAATCGACATTGATCCTGATGCGCCCAAACAAAAGCCCATACGCCGCCACAATCGCTCCTCGGACCCCTCTGCCGACTCCTCCAACCATGAGTCCTCTAGTGGTGGCTACCGCCGTCGTCGTGGATCCAACCATGGTGTAGAGTCTTCGTCATCACAGGATATGCCACCGACTGGTGTCAAAACAAACCGAAGAAAATCAAAGGCCTCTGAAAACAGTTCGGTGAAGAAGCCTTCGTCTCGAAGATCATCCAAAGTAGATTCTCTAACTGATATTTCTATTTCAGATTTTGGGTCTGGCTCTGGACCCGAAAGTGGGCTTACAGCCATTAGGATTTAA
Predicted protein sequences of Glyma10g00701
>Glyma10g00701.1   sequence type=predicted peptide   gene model=Glyma10g00701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHHHQHLLISGRLINFWCKYINELYLHKLMPTKVKGLLKYISQIFEEKEEEFQIGLPTDVRHVAHIGSDDPSANAPSWMNDIKRGKEPPSGNPTQTVEECEKKSSSNSKRSKIRNHLIPKSRHTSIDIDPDAPKQKPIRRHNRSSDPSADSSNHESSSGGYRRRRGSNHGVESSSSQDMPPTGVKTNRRKSKASENSSVKKPSSRRSSKVDSLTDISISDFGSGSGPESGLTAIRI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo