Report for Sequence Feature Glyma10g00470
Feature Type: gene_model
Chromosome: Gm10
Start: 248104
stop: 250721
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g00470
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G22930 AT
Annotation by Michelle Graham. TAIR10: calmodulin-like 11 | chr3:8124286-8125835 REVERSE LENGTH=173
SoyBase E_val: 1.00E-85 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0030048 GO-bp
Annotation by Michelle Graham. GO Biological Process: actin filament-based movement
SoyBase N/A ISS
GO:0051645 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi localization
SoyBase N/A ISS
GO:0051646 GO-bp
Annotation by Michelle Graham. GO Biological Process: mitochondrion localization
SoyBase N/A ISS
GO:0060151 GO-bp
Annotation by Michelle Graham. GO Biological Process: peroxisome localization
SoyBase N/A ISS
GO:0005509 GO-mf
Annotation by Michelle Graham. GO Molecular Function: calcium ion binding
SoyBase N/A ISS
KOG0027
KOG
Calmodulin and related proteins (EF-Hand superfamily)
JGI ISS
PTHR23050 Panther
CALCIUM BINDING PROTEIN
JGI ISS
PTHR23050:SF20 Panther
CALMODULIN
JGI ISS
PF00036 PFAM
EF hand
JGI ISS
UniRef100_C6T2Y6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Y6_SOYBN
SoyBase E_val: 2.00E-100 ISS
UniRef100_Q43447 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin n=1 Tax=Glycine max RepID=Q43447_SOYBN
SoyBase E_val: 2.00E-92 ISS
Expression Patterns of Glyma10g00470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g00470
Paralog Evidence Comments
Glyma02g00450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g00470 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g002200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g00470
Coding sequences of Glyma10g00470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g00470.1 sequence type=CDS gene model=Glyma10g00470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGATGTCCTGAGTGAAGAACAGATTGGTGAGATCAAAGAAGCCTTTGGCTTGTTTGACAAAGATGGAGATGGGTGCATTACTGTGGAAGAATTGGCCACTGTTATTCGGTCATTGGATCAGAACCCCACAGAAGAAGAGCTCCAAGACATGATAAACGAGGTCGATACAGATGGCAATGGAACCATTGAATTTGTTGAGTTTTTGAACTTAATGGCCAAGAAAATGAAGGAAACTGATGCAGAGGAAGATCTCAAAGAGGCTTTCAAGGTGTTTGACAAGGATCAAAATGGCTACATTTCAGCAAGTGAGTTGAGGCACGTTATGATCAATCTGGGTGAAAAACTAACTGATGAAGAGGTGGAGCAGATGATTAAAGAAGCTGATTTGGATGGTGATGGTCAAGTTGGCTATGATGAATTTGTCAAGATGATGATGATTATTGGATGA
Predicted protein sequences of Glyma10g00470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g00470.1 sequence type=predicted peptide gene model=Glyma10g00470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADVLSEEQIGEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDTDGNGTIEFVEFLNLMAKKMKETDAEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVGYDEFVKMMMIIG*