Report for Sequence Feature Glyma10g00371
Feature Type: gene_model
Chromosome: Gm10
Start: 145570
stop: 145917
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g00371
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G77840 AT
Annotation by Michelle Graham. TAIR10: Translation initiation factor IF2/IF5 | chr1:29269087-29270400 FORWARD LENGTH=437
SoyBase E_val: 4.00E-29 ISS
GO:0006413 GO-bp
Annotation by Michelle Graham. GO Biological Process: translational initiation
SoyBase N/A ISS
GO:0006446 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of translational initiation
SoyBase N/A ISS
GO:0006865 GO-bp
Annotation by Michelle Graham. GO Biological Process: amino acid transport
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0003743 GO-mf
Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity
SoyBase N/A ISS
PTHR23001 Panther
EUKARYOTIC TRANSLATION INITIATION FACTOR
JGI ISS
PF02020 PFAM
eIF4-gamma/eIF5/eIF2-epsilon
JGI ISS
UniRef100_P48724 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 5 n=1 Tax=Phaseolus vulgaris RepID=IF5_PHAVU
SoyBase E_val: 1.00E-48 ISS
UniRef100_UPI000233C210 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233C210 related cluster n=1 Tax=unknown RepID=UPI000233C210
SoyBase E_val: 5.00E-61 ISS
Expression Patterns of Glyma10g00371
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g00371
Paralog Evidence Comments
Glyma02g00220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g00371 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g001300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g00371
Coding sequences of Glyma10g00371
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g00371.1 sequence type=CDS gene model=Glyma10g00371 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTGCTCTGGTTGAAGCTCTATTCGAGGGAACTGAGAAAGGTTTAGCTAAAGAAGCTGGATCCCAGCTGTTATTGCTTCATGCTATCGAAGAATTTTCTTGCAAGTCTACTTCCAATGCTTTGAAGGAGGTTGCCCTGGTTCTAAAGGCACTCTACGATGCTGATGTGTTGGAGGAAGAGCACATAGTGCAGTGGTATCAAAAGGGACTGAAGGGCGAAAACAAGAACTCCAAGATTTGGAAGAATGTTCAACCTTTCATTGATTGGCTTCAGAGTGCAGAATCAGAAACCGAGGAAGAATAA
Predicted protein sequences of Glyma10g00371
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g00371.1 sequence type=predicted peptide gene model=Glyma10g00371 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSALVEALFEGTEKGLAKEAGSQLLLLHAIEEFSCKSTSNALKEVALVLKALYDADVLEEEHIVQWYQKGLKGENKNSKIWKNVQPFIDWLQSAESETEEE*