SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g00371

Feature Type:gene_model
Chromosome:Gm10
Start:145570
stop:145917
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g00371
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77840AT Annotation by Michelle Graham. TAIR10: Translation initiation factor IF2/IF5 | chr1:29269087-29270400 FORWARD LENGTH=437 SoyBaseE_val: 4.00E-29ISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0006446GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translational initiation SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
PTHR23001Panther EUKARYOTIC TRANSLATION INITIATION FACTOR JGI ISS
PF02020PFAM eIF4-gamma/eIF5/eIF2-epsilon JGI ISS
UniRef100_P48724UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 5 n=1 Tax=Phaseolus vulgaris RepID=IF5_PHAVU SoyBaseE_val: 1.00E-48ISS
UniRef100_UPI000233C210UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C210 related cluster n=1 Tax=unknown RepID=UPI000233C210 SoyBaseE_val: 5.00E-61ISS

Expression Patterns of Glyma10g00371
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g00371 not represented in the dataset
Glyma10g00371 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g00371
ParalogEvidenceComments
Glyma02g00220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g00371 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g001300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g00371
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g00371
>Glyma10g00371.1   sequence type=CDS   gene model=Glyma10g00371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGCTCTGGTTGAAGCTCTATTCGAGGGAACTGAGAAAGGTTTAGCTAAAGAAGCTGGATCCCAGCTGTTATTGCTTCATGCTATCGAAGAATTTTCTTGCAAGTCTACTTCCAATGCTTTGAAGGAGGTTGCCCTGGTTCTAAAGGCACTCTACGATGCTGATGTGTTGGAGGAAGAGCACATAGTGCAGTGGTATCAAAAGGGACTGAAGGGCGAAAACAAGAACTCCAAGATTTGGAAGAATGTTCAACCTTTCATTGATTGGCTTCAGAGTGCAGAATCAGAAACCGAGGAAGAATAA
Predicted protein sequences of Glyma10g00371
>Glyma10g00371.1   sequence type=predicted peptide   gene model=Glyma10g00371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSALVEALFEGTEKGLAKEAGSQLLLLHAIEEFSCKSTSNALKEVALVLKALYDADVLEEEHIVQWYQKGLKGENKNSKIWKNVQPFIDWLQSAESETEEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo