SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g00291

Feature Type:gene_model
Chromosome:Gm10
Start:94698
stop:95423
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g00291
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14560AT Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible | chr4:8361182-8361780 FORWARD LENGTH=168 SoyBaseE_val: 4.00E-36ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_P49679UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein IAA4 n=1 Tax=Pisum sativum RepID=IAA4_PEA SoyBaseE_val: 6.00E-40ISS
UniRef100_UPI000233C20CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C20C related cluster n=1 Tax=unknown RepID=UPI000233C20C SoyBaseE_val: 2.00E-45ISS

Expression Patterns of Glyma10g00291
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g00291 not represented in the dataset
Glyma10g00291 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g00291 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g000700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g00291
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g00291
>Glyma10g00291.1   sequence type=CDS   gene model=Glyma10g00291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGGAGCCCCTTACCTAAGAAAGATTGATTTGAGAGTCTATGTTCAAGCTTTAGAGACCATGTTCAAGTTGACCATAGGTGAGTACTCTAAAAGAGAGGGTTATAAGGGATCTGAATATGCACCTACATATGAAGACAAGGATGGTGACTGGATGCTAGTTGGAGATGTTCCATTGGACATGTTTATGACTTCCTGCAAAAGGCTAAGAGTCATGTGA
Predicted protein sequences of Glyma10g00291
>Glyma10g00291.1   sequence type=predicted peptide   gene model=Glyma10g00291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDGAPYLRKIDLRVYVQALETMFKLTIGEYSKREGYKGSEYAPTYEDKDGDWMLVGDVPLDMFMTSCKRLRVM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo