SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g42031): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g42031): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g42031

Feature Type:gene_model
Chromosome:Gm09
Start:46693881
stop:46695064
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G33520AT Annotation by Michelle Graham. TAIR10: D111/G-patch domain-containing protein | chr1:12157488-12158876 REVERSE LENGTH=462 SoyBaseE_val: 2.00E-25ISS
GO:0009870GO-bp Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-dependent SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
PTHR15818Panther G PATCH AND KOW-CONTAINING JGI ISS
PTHR15818:SF2Panther gb def: t54 protein JGI ISS
PF01585PFAM G-patch domain JGI ISS
UniRef100_B9SAH9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein MOS2, putative n=1 Tax=Ricinus communis RepID=B9SAH9_RICCO SoyBaseE_val: 2.00E-33ISS
UniRef100_C6T4Y8UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T4Y8_SOYBN SoyBaseE_val: 2.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g42031 not represented in the dataset

Glyma09g42031 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g00430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g283500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g42031.1   sequence type=CDS   gene model=Glyma09g42031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAGTTGTCTTTCTCCATCCCCACCGCAAAACCCCAATCGGTGGACACTTCCACCACCCGAAAGGACGACGACAGCGACGGAACCAAACAGTACATCACCGAATTCGACCCTTCCAAACCCGCAAACCCCAAAATCACAATCCCCCCAATCCAAAACCAGTGGAACCCCCAACAAGACAACGAACACAGCACCACGCGGTGGCGCCGCACTCCGGAGGAGACCGAGCTGCTGCGTAAGCTGAAACTGGAGGAAGATCTGCAGAGGTTGCCGGAGGACCAGGGGTTGGAGGAGTTCAAGGATGTCCCCGTCGAGGTTTTCGGCGAGGCGTTGCTCGCTGGGTATGGCTGGACGGAAGGGATGGGGATTGGGAAGAAGGCCAAAGAGGACGTGAAGGTGGTACAGGTCAAGGGGAGAACCTCAAGGGAAGGATTAGGGTTCGTTGCCAATGCTTCTGGCAACAATTTGAATCACTGCGACCATCATTTATGTAATTTGCAGTTCTAG

>Glyma09g42031.1   sequence type=predicted peptide   gene model=Glyma09g42031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKLSFSIPTAKPQSVDTSTTRKDDDSDGTKQYITEFDPSKPANPKITIPPIQNQWNPQQDNEHSTTRWRRTPEETELLRKLKLEEDLQRLPEDQGLEEFKDVPVEVFGEALLAGYGWTEGMGIGKKAKEDVKVVQVKGRTSREGLGFVANASGNNLNHCDHHLCNLQF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo