Glyma09g42010 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g42010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g42010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g42010

Feature Type:	gene_model
Chromosome:	Gm09
Start:	46683751
stop:	46685308
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g42010

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08290	AT	Annotation by Michelle Graham. TAIR10: mRNA splicing factor, thioredoxin-like U5 snRNP \| chr5:2666043-2666936 FORWARD LENGTH=142	SoyBase	E_val: 9.00E-104	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0007033	GO-bp	Annotation by Michelle Graham. GO Biological Process: vacuole organization	SoyBase	N/A	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005681	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: spliceosomal complex	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
KOG3414	KOG	Component of the U4/U6.U5 snRNP/mitosis protein DIM1	JGI		ISS
PTHR12052	Panther	MITOSIS PROTEIN DIM1	JGI		ISS
PF02966	PFAM	Mitosis protein DIM1	JGI		ISS
UniRef100_A9PCP7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=4 Tax=rosids RepID=A9PCP7_POPTR	SoyBase	E_val: 1.00E-101	ISS
UniRef100_F8RWT4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitosis protein YLS8 n=1 Tax=Hevea brasiliensis RepID=F8RWT4_HEVBR	SoyBase	E_val: 1.00E-101	ISS

Expression Patterns of Glyma09g42010

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g42010 not represented in the dataset	Glyma09g42010 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g42010 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g283300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g42010

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g42010

Limit To All Plant Sequences

>Glyma09g42010.1   sequence type=CDS   gene model=Glyma09g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTACCTGTTGCCTCACTTGCACTCTGGATGGGCCGTCGATCAAGCAATCCTCGCCGAAGAGGAGCGTCTCGTCGTCATCCGTTTCGGCCACGACTGGGACGAAACCTGCATGCAGATGGACGAGGTGTTGGCGTCAGTGGCGGAGACGATAAAGAACTTTGCGGTGATATACCTGGTGGACATAACGGAGGTGCCGGATTTCAACACCATGTACGAGCTCTACGACCCTTCCACGGTGATGTTCTTCTTCAGGAACAAGCACATCATGATTGATCTCGGAACCGGTAACAACAACAAGATCAACTGGGCTCTCAAGGACAAGCAGGAGTTCATCGACATTGTTGAGACCGTCTATCGTGGAGCCAGGAAGGGACGGGGTCTCGTCATCGCTCCCAAAGATTACTCCACCAAGTACCGTTACTAG

Predicted protein sequences of Glyma09g42010

Limit To All Plant Sequences

>Glyma09g42010.1   sequence type=predicted peptide   gene model=Glyma09g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain