SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g42010

Feature Type:gene_model
Chromosome:Gm09
Start:46683751
stop:46685308
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g42010
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08290AT Annotation by Michelle Graham. TAIR10: mRNA splicing factor, thioredoxin-like U5 snRNP | chr5:2666043-2666936 FORWARD LENGTH=142 SoyBaseE_val: 9.00E-104ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007033GO-bp Annotation by Michelle Graham. GO Biological Process: vacuole organization SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0016197GO-bp Annotation by Michelle Graham. GO Biological Process: endosomal transport SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005681GO-cc Annotation by Michelle Graham. GO Cellular Compartment: spliceosomal complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
KOG3414 KOG Component of the U4/U6.U5 snRNP/mitosis protein DIM1 JGI ISS
PTHR12052Panther MITOSIS PROTEIN DIM1 JGI ISS
PF02966PFAM Mitosis protein DIM1 JGI ISS
UniRef100_A9PCP7UniRef Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=4 Tax=rosids RepID=A9PCP7_POPTR SoyBaseE_val: 1.00E-101ISS
UniRef100_F8RWT4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitosis protein YLS8 n=1 Tax=Hevea brasiliensis RepID=F8RWT4_HEVBR SoyBaseE_val: 1.00E-101ISS

Expression Patterns of Glyma09g42010
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g42010 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g283300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g42010
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g42010
>Glyma09g42010.1   sequence type=CDS   gene model=Glyma09g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTACCTGTTGCCTCACTTGCACTCTGGATGGGCCGTCGATCAAGCAATCCTCGCCGAAGAGGAGCGTCTCGTCGTCATCCGTTTCGGCCACGACTGGGACGAAACCTGCATGCAGATGGACGAGGTGTTGGCGTCAGTGGCGGAGACGATAAAGAACTTTGCGGTGATATACCTGGTGGACATAACGGAGGTGCCGGATTTCAACACCATGTACGAGCTCTACGACCCTTCCACGGTGATGTTCTTCTTCAGGAACAAGCACATCATGATTGATCTCGGAACCGGTAACAACAACAAGATCAACTGGGCTCTCAAGGACAAGCAGGAGTTCATCGACATTGTTGAGACCGTCTATCGTGGAGCCAGGAAGGGACGGGGTCTCGTCATCGCTCCCAAAGATTACTCCACCAAGTACCGTTACTAG
Predicted protein sequences of Glyma09g42010
>Glyma09g42010.1   sequence type=predicted peptide   gene model=Glyma09g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo